TkA07G230600 | RubberDandelionOmics

Gene overview

TkA07G230600

Reference: TK1151 Chr: Chr07 Coordinates: 57723513-57731919 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1749 bp · TkA07G230600|TK1151|cDNA

AAAAAAAAAAAAAAAGAGAGTCAACTTCCTTGAAACAGATTTTCGCACGGGCAATAAAACCGTTCCCTCGCTTGTTCGGTTTAGGCTTCTTCCAGCAAAGAAAGACATAATACAGCAGAGAAAAGGTACTTCGCCAGTTCACTAGGGTCCTCTCCTACCCCGATTCCCCTGTATATTATTAGGGTTTCAGTTTGTTCTTCCTTTCTTCTTACTAGTCCTTGTAGAATTCCATTCTACCAAAAATATCGATTACAATGAGT...

CDS

Download CDS FASTA

1044 bp · TkA07G230600|TK1151|CDS

ATGAGTAGTAATCAAGAAGATCAGTTCAATATGGCCGATCTTTGTTCCACTCTCCCTGCTGCTACTTCTGCTCTTACCGCTGAGGATCGTGCTGGACTTGTCGACGTCCTAAAGAATAAACTTGAGAATTTGACCGGAAAACATCCTGATTTCTTGGACACTCTTTCATCTAATGTTAGGCAACGAGTTGGTGTTCTTAAGGACCTTCAGAGTCAATATGATGAGCTGGAGGCTAAGTATCTCGAAGAGAAGGCAGAACT...

Protein

Download Protein FASTA

347 aa · TkA07G230600|TK1151|PROTEIN

MSSNQEDQFNMADLCSTLPAATSALTAEDRAGLVDVLKNKLENLTGKHPDFLDTLSSNVRQRVGVLKDLQSQYDELEAKYLEEKAELEAKYMKLYEPLYSKRYEIVNGLTEVEGVLDNNLVDKENNESKGDKGVPNFWLTAMKSNEVLADEISEADEGALQYLKDIKWSRITGAKGFKLELFFDPNPYFKNSVLSKTYEMINEEEHILEKAVGTEIEWCTGKNLTQKVLRKKVNKGGSKVPITKIQECESFFNFFNPPQI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G230600`
TK1151 ID	TkA07G230600
OH-1004 ID	LXL04_032201
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	62.700
Protein coverage (%)	TK1151 89.914 / OH-1004 82.850 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G230600

Location Chr07:57723513-57731919 (-)

Description Similar to NAP1;2: Nucleosome assembly protein 1;2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g19480`	May modulate chromatin structure by regulation of nucleosome assembly/disassembly (By similarity).	Molecular and reverse genetic characterization of NUCLEOSOME ASSEMBLY PROTEIN1 (NAP1) genes unravels their function in transcription and nucleotide excision repair in Arabidopsis thaliana.2009 · DOI: 10.1111/j.1365-313x.2009.03844.x

Rice

Reference gene ID	Possible function	Papers / DOI
`Os06g0149400`	May modulate chromatin structure by regulation of nucleosome assembly/disassembly.	No verified direct reference in this release
`UniProt: B8B2R4`	May modulate chromatin structure by regulation of nucleosome assembly/disassembly.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032201 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000724 double-strand break repair via homologous recombination Biological Process

GO:0006281 DNA repair Biological Process

GO:0006334 nucleosome assembly Biological Process

GO:0009294 DNA-mediated transformation Biological Process

GO:0016444 somatic cell DNA recombination Biological Process

GO:0000785 chromatin Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009536 plastid Cellular Component

GO:0003682 chromatin binding Molecular Function

KEGG gene cross-reference

ath:AT2G19480

ath:AT5G56950

dosa:Os05g0539700

nta:107760768

osa:4339460

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.642

Rank 1 · TkA07G230600 · TK1151

Nucleus0.543

Rank 2 · TkA07G230600 · TK1151

Mitochondrion0.055

Rank 3 · TkA07G230600 · TK1151

Cell membrane0.036

Rank 4 · TkA07G230600 · TK1151

Endoplasmic reticulum0.034

Rank 5 · TkA07G230600 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08895DUF184023-43 aa

PF00956NAP61-304 aa

PF0209660KD_IMP66-96 aa

PF14088DUF426868-82 aa

PF15912VIR_N175-184 aa

PF14088DUF4268196-256 aa

PF15912VIR_N256-335 aa

PF05327RRN3259-341 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G230600	`PF08895`	DUF1840	23	43	0.34	11.9
TkA07G230600	`PF00956`	NAP	61	304	3.8e-82	276.2
TkA07G230600	`PF02096`	60KD_IMP	66	96	0.35	11.4
TkA07G230600	`PF14088`	DUF4268	68	82	0.084	13.6
TkA07G230600	`PF15912`	VIR_N	175	184	3.5	7.7
TkA07G230600	`PF14088`	DUF4268	196	256	0.084	13.6
TkA07G230600	`PF15912`	VIR_N	256	335	3.5	7.7
TkA07G230600	`PF05327`	RRN3	259	341	7.4	5.7
TkA07G230600	`PF09073`	BUD22	264	340	1.7	8.6
TkA07G230600	`PF08895`	DUF1840	267	330	0.34	11.9
TkA07G230600	`PF00956`	NAP	319	328	3.8e-82	276.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZUP3`	Arabidopsis thaliana	sp\|Q9ZUP3\|NAP1B_ARATH Nucleosome assembly protein 1;2	60.800%	Swiss-Prot	High
`Q5VND6`	Oryza sativa subsp. japonica	sp\|Q5VND6\|NAP1A_ORYSJ Nucleosome assembly protein 1;1	61.600%	Swiss-Prot	High
`B8B2R4`	Oryza sativa subsp. indica	sp\|B8B2R4\|NAP1A_ORYSI Nucleosome assembly protein 1;1	61.600%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card