TkA07G120500 | RubberDandelionOmics

Gene overview

TkA07G120500

Reference: TK1151 Chr: Chr07 Coordinates: 31259707-31262913 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1805 bp · TkA07G120500|TK1151|cDNA

CGGCTGTGAATTAGCAATAACTGATCTTTAAATCTGCCACCATACGCCAGCATTCTTCTAACAACGACGAATGGTATCATTCCAGCATAAAACCCTTTCTCTCTCCTCTATTTTAGTACCCGATTCCCTTGTGTCTTTGTCAATTGTCGACATAAGTTCTAATTCTCCGCCGGCAACGACCTGTATAAACTTTCCGTTGTATGTATATCGGCGGTGGTGGAGGATGGTGATGACGGTGGCGTCGCCTAAAAACTCGTTAA...

CDS

Download CDS FASTA

1527 bp · TkA07G120500|TK1151|CDS

ATGGTATCATTCCAGCATAAAACCCTTTCTCTCTCCTCTATTTTAGTACCCGATTCCCTTGTGTCTTTGTCAATTGTCGACATAAGTTCTAATTCTCCGCCGGCAACGACCTGTATAAACTTTCCGTTGTATGTATATCGGCGGTGGTGGAGGATGGTGATGACGGTGGCGTCGCCTAAAAACTCGTTAAAGACAGTGTTCGAGAGAGTCGGAGTTTATGGATTTGGCGGCGGGAGTAGCAACAGGCAGAAAAGAGTAAG...

Protein

Download Protein FASTA

508 aa · TkA07G120500|TK1151|PROTEIN

MVSFQHKTLSLSSILVPDSLVSLSIVDISSNSPPATTCINFPLYVYRRWWRMVMTVASPKNSLKTVFERVGVYGFGGGSSNRQKRVRYEIHEEDHDNMEMVQLGANRTKNVLILMSDTGGGHRASAEAIRDAFKIEFGDEYKIFVKDVWKEYTGWPLNDMENQYKFMVKHVQLWSVAFHGTSPRWIHGVYLAAIAAFYAKEVEAGLMEYKPDIIISVHPMMQHIPLWVLKWQGLQKKVVFVTVITDLNTCHRTWFHPRVK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G120500`
TK1151 ID	TkA07G120500
OH-1004 ID	LXL04_028090
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.800
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G120500

Location Chr07:31259707-31262913 (-)

Description Similar to MGD2: Monogalactosyldiacylglycerol synthase 2, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g20410`	Involved in the synthesis of monogalactosyldiacylglycerol, the major structural component of photosynthetic membranes and in the chloroplast envelope biogenesis.	Two types of MGDG synthase genes, found widely in both 16:3 and 18:3 plants, differentially mediate galactolipid syntheses in photosynthetic and nonphotosynthetic tissues in Arabidopsis thaliana.2001 · DOI: 10.1073/pnas.181331498 Type-B monogalactosyldiacylglycerol synthases are involved in phosphate starvation-induced lipid remodeling, and are crucial for low-phosphate adaptation.2009 · DOI: 10.1111/j.1365-313x.2008.03692.x Lipid remodeling under acidic conditions and its interplay with low Pi stress in Arabidopsis.2019 · DOI: 10.1007/s11103-019-00891-1
`At2g11810`	Involved in the synthesis of monogalactosyldiacylglycerol, the major structural component of photosynthetic membranes and in the chloroplast envelope biogenesis.	Two types of MGDG synthase genes, found widely in both 16:3 and 18:3 plants, differentially mediate galactolipid syntheses in photosynthetic and nonphotosynthetic tissues in Arabidopsis thaliana.2001 · DOI: 10.1073/pnas.181331498 Type-B monogalactosyldiacylglycerol synthases are involved in phosphate starvation-induced lipid remodeling, and are crucial for low-phosphate adaptation.2009 · DOI: 10.1111/j.1365-313x.2008.03692.x

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0802700`	Involved in the synthesis of the major structural component of photosynthetic membranes.	No verified direct reference in this release
`Os08g0299400`	Involved in the synthesis of the major structural component of photosynthetic membranes.	No verified direct reference in this release
`UniProt: A2YTP9`	Involved in the synthesis of the major structural component of photosynthetic membranes.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_028090 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006631 fatty acid metabolic process Biological Process

GO:0009247 glycolipid biosynthetic process Biological Process

GO:0016036 cellular response to phosphate starvation Biological Process

GO:0019374 galactolipid metabolic process Biological Process

GO:0019375 galactolipid biosynthetic process Biological Process

GO:0009507 chloroplast Cellular Component

GO:0009707 chloroplast outer membrane Cellular Component

GO:0031969 chloroplast membrane Cellular Component

GO:0035250 UDP-galactosyltransferase activity Molecular Function

GO:0046509 1,2-diacylglycerol 3-beta-galactosyltransferase activity Molecular Function

KEGG gene cross-reference

ath:AT2G11810

ath:AT5G20410

dosa:Os02g0802700

dosa:Os08g0299400

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.938

Rank 1 · TkA07G120500 · TK1151

Cytoplasm0.042

Rank 2 · TkA07G120500 · TK1151

Mitochondrion0.034

Rank 3 · TkA07G120500 · TK1151

Cell membrane0.034

Rank 4 · TkA07G120500 · TK1151

Peroxisome0.031

Rank 5 · TkA07G120500 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF06925MGDG_synth46-69 aa

PF06925MGDG_synth122-290 aa

PF13439Glyco_transf_4197-287 aa

PF04101Glyco_tran_28_C317-415 aa

PF13692Glyco_trans_1_4353-423 aa

PF06722EryCIII-like_C372-472 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G120500	`PF06925`	MGDG_synth	46	69	3.3e-62	210.2
TkA07G120500	`PF06925`	MGDG_synth	122	290	3.3e-62	210.2
TkA07G120500	`PF13439`	Glyco_transf_4	197	287	0.21	12.3
TkA07G120500	`PF04101`	Glyco_tran_28_C	317	415	3.2e-09	37.8
TkA07G120500	`PF13692`	Glyco_trans_1_4	353	423	0.067	14.2
TkA07G120500	`PF06722`	EryCIII-like_C	372	472	0.0008	20.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O82730`	Arabidopsis thaliana	sp\|O82730\|MGDG2_ARATH Monogalactosyldiacylglycerol synthase 2, chloroplastic	80.500%	Swiss-Prot	High
`Q9SI93`	Arabidopsis thaliana	sp\|Q9SI93\|MGDG3_ARATH Monogalactosyldiacylglycerol synthase 3, chloroplastic	78.000%	Swiss-Prot	High
`Q0DWQ1`	Oryza sativa subsp. japonica	sp\|Q0DWQ1\|MGDG3_ORYSJ Probable monogalactosyldiacylglycerol synthase 3, chloroplastic	77.500%	Swiss-Prot	High
`Q6UTZ2`	Oryza sativa subsp. japonica	sp\|Q6UTZ2\|MGDG2_ORYSJ Probable monogalactosyldiacylglycerol synthase 2, chloroplastic	64.900%	Swiss-Prot	High
`A2YTP9`	Oryza sativa subsp. indica	sp\|A2YTP9\|MGDG2_ORYSI Probable monogalactosyldiacylglycerol synthase 2, chloroplastic	64.900%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card