TkA07G100690 | RubberDandelionOmics

Gene overview

TkA07G100690

Reference: TK1151 Chr: Chr07 Coordinates: 26232734-26234626 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

992 bp · TkA07G100690|TK1151|cDNA

CGTCAAGTCCGTGACTATTTGCGTAGCTCTAAATCAAAATTGCTGGGTATATAGGCGACGGCGCCGCTCAAAGCTTATTCCATGGCGCCGGAGAAAGCACAGTCTACGGTCGTCGAAGATACGATGATCATATGGGATTTTGATCGGACGATTATGGACGACGATAGTGATCGGTGGGTGGTGGTACACATGGGTTTGACTCAACTGTTCAATCAGCTTCGCGAAACATTGCCTTGGAATACTCTCATGGATAGAATGAT...

CDS

Download CDS FASTA

750 bp · TkA07G100690|TK1151|CDS

ATGGCGCCGGAGAAAGCACAGTCTACGGTCGTCGAAGATACGATGATCATATGGGATTTTGATCGGACGATTATGGACGACGATAGTGATCGGTGGGTGGTGGTACACATGGGTTTGACTCAACTGTTCAATCAGCTTCGCGAAACATTGCCTTGGAATACTCTCATGGATAGAATGATGGAAGAGCTACATTCTCAGGGAAAAACAATCGAAGATATCATAAACTGTTTAAATCGCGTTCCATTACATCCAAAAATCAT...

Protein

Download Protein FASTA

249 aa · TkA07G100690|TK1151|PROTEIN

MAPEKAQSTVVEDTMIIWDFDRTIMDDDSDRWVVVHMGLTQLFNQLRETLPWNTLMDRMMEELHSQGKTIEDIINCLNRVPLHPKIISAIKSAHTLGCDLKVLSDANTFFIETILKNHGVYDCFSEIISNPTFVDKEGRLRIFPYHGSTLPPHGCDLCPPNLCKGLVLNKIRDSNLESKKVIIYIGDGGGDFCPTLKLGEKDNVMPRKNFPLHGLILKSSVPIKPKVHEWSDGEELNRILIHLIRPGSE

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G100690`
TK1151 ID	TkA07G100690
OH-1004 ID	LXL04_008310
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	59.700
Protein coverage (%)	TK1151 92.369 / OH-1004 80.488 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G100690

Location Chr07:26232734-26234626 (-)

Description Similar to At1g17710: Inorganic pyrophosphatase 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g29530`	HAD-like hydrolase that has a thiamine monophosphate phosphatase activity in a heterologous system.	Bacterial and plant HAD enzymes catalyse a missing phosphatase step in thiamin diphosphate biosynthesis.2016 · DOI: 10.1042/bj20150805
`At1g73010`	Catalyzes the specific cleavage of pyrophosphate.	The Arabidopsis thaliana phosphate starvation responsive gene AtPPsPase1 encodes a novel type of inorganic pyrophosphatase.2011 · DOI: 10.1016/j.bbagen.2010.11.006
`At1g17710`	Catalyzes the specific cleavage of pyrophosphate.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_008310 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006580 ethanolamine metabolic process Biological Process

GO:0009229 thiamine diphosphate biosynthetic process Biological Process

GO:0016036 cellular response to phosphate starvation Biological Process

GO:0051262 protein tetramerization Biological Process

GO:0071456 cellular response to hypoxia Biological Process

GO:0005634 nucleus Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0065010 extracellular membrane-bounded organelle Cellular Component

GO:1903561 extracellular vesicle Cellular Component

GO:0004427 inorganic diphosphate phosphatase activity Molecular Function

GO:0016462 pyrophosphatase activity Molecular Function

KEGG gene cross-reference

ath:AT1G17710

ath:AT1G73010

ath:AT4G29530

dre:100002812

xtr:493318

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.681

Rank 1 · TkA07G100690 · TK1151

Nucleus0.371

Rank 2 · TkA07G100690 · TK1151

Mitochondrion0.087

Rank 3 · TkA07G100690 · TK1151

Cell membrane0.065

Rank 4 · TkA07G100690 · TK1151

Endoplasmic reticulum0.058

Rank 5 · TkA07G100690 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF06888Put_Phosphatase15-244 aa

PF12710HAD16-140 aa

PF13419HAD_216-130 aa

PF10949DUF277735-84 aa

PF00702Hydrolase69-129 aa

PF13419HAD_2171-191 aa

PF00702Hydrolase177-189 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G100690	`PF06888`	Put_Phosphatase	15	244	2.7e-87	292.8
TkA07G100690	`PF12710`	HAD	16	140	1.7e-05	26.0
TkA07G100690	`PF13419`	HAD_2	16	130	0.0014	19.4
TkA07G100690	`PF10949`	DUF2777	35	84	0.2	12.2
TkA07G100690	`PF00702`	Hydrolase	69	129	0.0017	19.5
TkA07G100690	`PF13419`	HAD_2	171	191	0.0014	19.4
TkA07G100690	`PF00702`	Hydrolase	177	189	0.0017	19.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SU92`	Arabidopsis thaliana	sp\|Q9SU92\|PPSP3_ARATH Thiamine phosphate phosphatase-like protein	59.500%	Swiss-Prot	High
`Q67YC0`	Arabidopsis thaliana	sp\|Q67YC0\|PPSP1_ARATH Inorganic pyrophosphatase 1	56.300%	Swiss-Prot	High
`Q9FZ62`	Arabidopsis thaliana	sp\|Q9FZ62\|PPSP2_ARATH Inorganic pyrophosphatase 2	53.900%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card