LXL04_008310 | RubberDandelionOmics

Gene overview

LXL04_008310

Reference: OH-1004 Chr: Chr02 Coordinates: 96280708-96282093 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

864 bp · LXL04_008310|LXL04_008310|OH1004|cDNA

ATGGCTTTacaattatacaaaaaaaatcatCGTTATTTACGTGTGCTCGCAACAATGTCAGGAATCGTAGTAATTTTTGACTTCGACAAAACAATCATCGACATCGATAGCGACAATTGGGTAGTCGATGAGTTGGGTGCAACCGATCTATTCAACCAACTTCTTCCAACTATGCCTTGGAACTCCGTTATGGATAAGATGATGGAAGAGCTACATTTGCAAGGTAGAACCATCGAGGACATTGAGGAAGTACTTAAACG...

CDS

Download CDS FASTA

864 bp · LXL04_008310|LXL04_008310|OH1004|CDS

ATGGCTTTACAATTATACAAAAAAAATCATCGTTATTTACGTGTGCTCGCAACAATGTCAGGAATCGTAGTAATTTTTGACTTCGACAAAACAATCATCGACATCGATAGCGACAATTGGGTAGTCGATGAGTTGGGTGCAACCGATCTATTCAACCAACTTCTTCCAACTATGCCTTGGAACTCCGTTATGGATAAGATGATGGAAGAGCTACATTTGCAAGGTAGAACCATCGAGGACATTGAGGAAGTACTTAAACG...

Protein

Download Protein FASTA

287 aa · LXL04_008310|LXL04_008310|OH1004|PROTEIN

MALQLYKKNHRYLRVLATMSGIVVIFDFDKTIIDIDSDNWVVDELGATDLFNQLLPTMPWNSVMDKMMEELHLQGRTIEDIEEVLKRTPIHPRVVPAIKAAYALGCDLRVLSDANQFYIETILKHLGIRECFSEINTNPGFVDDERKLRILPYHDFHTFSHGCTLCPPNMCKGKIIERIQATLAKEGKKRIIYLGDGGGDFCPSLKLGENDYMMPRKDFPVWELICKNRQLLRAEVHEWTDGEDLERVLLQLIAKTMSME...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_008310`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_008310

Location Chr02:96280708-96282093 (-)

Description Similar to At1g17710: Inorganic pyrophosphatase 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g17710`	Catalyzes the specific cleavage of pyrophosphate.	No verified direct reference in this release
`At1g73010`	Catalyzes the specific cleavage of pyrophosphate.	The Arabidopsis thaliana phosphate starvation responsive gene AtPPsPase1 encodes a novel type of inorganic pyrophosphatase.2011 · DOI: 10.1016/j.bbagen.2010.11.006
`At4g29530`	HAD-like hydrolase that has a thiamine monophosphate phosphatase activity in a heterologous system.	Bacterial and plant HAD enzymes catalyse a missing phosphatase step in thiamin diphosphate biosynthesis.2016 · DOI: 10.1042/bj20150805

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_008310 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006580 ethanolamine metabolic process Biological Process

GO:0009229 thiamine diphosphate biosynthetic process Biological Process

GO:0016036 cellular response to phosphate starvation Biological Process

GO:0051262 protein tetramerization Biological Process

GO:0071456 cellular response to hypoxia Biological Process

GO:0005634 nucleus Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0065010 extracellular membrane-bounded organelle Cellular Component

GO:1903561 extracellular vesicle Cellular Component

GO:0004427 inorganic diphosphate phosphatase activity Molecular Function

GO:0016462 pyrophosphatase activity Molecular Function

KEGG gene cross-reference

ath:AT1G17710

ath:AT1G73010

ath:AT4G29530

dre:100002812

xtr:493318

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.577

Rank 1 · LXL04_008310 · OH-1004

Nucleus0.373

Rank 2 · LXL04_008310 · OH-1004

Cell membrane0.101

Rank 3 · LXL04_008310 · OH-1004

Mitochondrion0.097

Rank 4 · LXL04_008310 · OH-1004

Endoplasmic reticulum0.077

Rank 5 · LXL04_008310 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF06888.19Put_Phosphatase22-253 aa

PF12710.14HAD24-135 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_008310	`PF06888.19`	Put_Phosphatase	22	253	1.4e-95	319.9
LXL04_008310	`PF12710.14`	HAD	24	135	1.6e-07	32.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FZ62`	Arabidopsis thaliana	Inorganic pyrophosphatase 2	62.044%	Swiss-Prot	strong database homology
`Q67YC0`	Arabidopsis thaliana	Inorganic pyrophosphatase 1	61.151%	Swiss-Prot	strong database homology
`Q9SU92`	Arabidopsis thaliana	Thiamine phosphate phosphatase-like protein	52.033%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card