RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA07G084790
Reference: TK1151 Chr: Chr07 Coordinates: 22139810-22143896 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

2716 bp · TkA07G084790|TK1151|cDNA

TAGAAACATGACCAAAGCCTAGGGACCATTTGTGAAGCTTAATATTGGGCTTTGGCCTGGGCTCTTTATCTACTTTACAAATCTTTATTGGGCCGGACGTCTTATTCCATTTACGCGGGACCATCATTATTTTCCCGCCAGAACACTTCACTAACACCTCTGCTCTTCCCGCCCAAACAACACAACACATTTAGGGCAAAGTTTCACCTCTCTTCCTCTCTGCATCTTCTCGTCGTTCCCCGATCATCCTCTCTCTAATC...

CDS

Download CDS FASTA

2304 bp · TkA07G084790|TK1151|CDS

ATGGACATCAGCGAAGAACAAAGGGCTTCCAACAAAAAGGCTTTCAGCGAATTGTTCGACACAAACGATAGTCTAGATGAAGATATCAGGAGCATGATCCACAACCAGCGCCGTCGTTTGATTTTTCAGCTTTCCCACCTCTTTCAACGCGGAGCGGAGGATTTAGCTCGACGGTTACTACAGACTCCTAACGAATATATCCAGTCGCTGTCGGATTTCATAACGGAAAGAACACGGAGCATCGACCCGAAGTTTCTAAA...

Protein

Download Protein FASTA

767 aa · TkA07G084790|TK1151|PROTEIN

MDISEEQRASNKKAFSELFDTNDSLDEDIRSMIHNQRRRLIFQLSHLFQRGAEDLARRLLQTPNEYIQSLSDFITERTRSIDPKFLKEGEQVLVGFDGPFVSRKVTPRDLLSEFIGSMVKVEGIITKCSLVRPKVVKSVHFCPSTNQFTSREYRDITSTMGLPTGSVYPTRDDNGNLLVTEYGLCNYKDHQTLSMQEVPENSAPGQLPRTVDVIAEDDLVDSCKPGDRVAIVGVYKAIPGKSQGSVNGVFRTVLIANNVY...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA07G084790
TK1151 IDTkA07G084790
OH-1004 IDLXL04_027668
Relationship / confidenceMulti Source To Oh1004 / Complex relationship
Protein identity (%)99.700
Protein coverage (%)TK1151 100.000 / OH-1004 100.000
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA07G084790
LocationChr07:22139810-22143896 (-)
DescriptionSimilar to MCM3: DNA replication licensing factor MCM3
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At5g46280 Probable component of the MCM2-7 complex (MCM complex) that may function as a DNA helicase and which is essential to undergo a single round of replication initiation and elongation per cell cycle in eukaryotic cells.
Two E2F sites in the Arabidopsis MCM3 promoter have different roles in cell cycle activation and meristematic expression.2002 · DOI: 10.1074/jbc.m205125200

Rice

Reference gene IDPossible functionPapers / DOI
UniProt: B8AZ99 Probable component of the MCM2-7 complex (MCM complex) that may function as a DNA helicase and which is essential to undergo a single round of replication initiation and elongation per cell cycle in eukaryotic cells. No verified direct reference in this release
Os05g0476200 Probable component of the MCM2-7 complex (MCM complex) that may function as a DNA helicase and which is essential to undergo a single round of replication initiation and elongation per cell cycle in eukaryotic cells. No verified direct reference in this release
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_027668 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0000727 double-strand break repair via break-induced replication Biological Process
GO:0006271 DNA strand elongation involved in DNA replication Biological Process
GO:1902975 mitotic DNA replication initiation Biological Process
GO:0000347 THO complex Cellular Component
GO:0000785 chromatin Cellular Component
GO:0005634 nucleus Cellular Component
GO:0042555 MCM complex Cellular Component
GO:0003678 DNA helicase activity Molecular Function
GO:0003697 single-stranded DNA binding Molecular Function
GO:0005524 ATP binding Molecular Function
GO:0016887 ATP hydrolysis activity Molecular Function
KEGG gene cross-reference
ath:AT5G46280
dosa:Os05g0476200
zma:542738
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.930
Rank 1 · TkA07G084790 · TK1151
Cytoplasm0.141
Rank 2 · TkA07G084790 · TK1151
Mitochondrion0.027
Rank 3 · TkA07G084790 · TK1151
Cell membrane0.016
Rank 4 · TkA07G084790 · TK1151
Endoplasmic reticulum0.007
Rank 5 · TkA07G084790 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23191WHD_MCM3_C3-24 aa
PF14551MCM_N27-92 aa
PF17207MCM_OB108-239 aa
PF23191WHD_MCM3_C143-160 aa
PF00493MCM275-498 aa
PF01078Mg_chelatase330-356 aa
PF07728AAA_5333-449 aa
PF00004AAA334-447 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA07G084790PF23191WHD_MCM3_C3241.1e-0732.7
TkA07G084790PF14551MCM_N27928.6e-0626.8
TkA07G084790PF17207MCM_OB1082391.1e-29103.4
TkA07G084790PF23191WHD_MCM3_C1431601.1e-0732.7
TkA07G084790PF00493MCM2754981e-95319.8
TkA07G084790PF01078Mg_chelatase3303563.1e-0937.2
TkA07G084790PF07728AAA_53334490.007317.0
TkA07G084790PF00004AAA3344470.03315.4
TkA07G084790PF07726AAA_33704520.0005120.6
TkA07G084790PF00158Sigma54_activat3814460.01216.0
TkA07G084790PF01078Mg_chelatase3824493.1e-0937.2
TkA07G084790PF23191WHD_MCM3_C4054151.1e-0732.7
TkA07G084790PF17855MCM_lid5526354.3e-2795.1
TkA07G084790PF25830Ig_NFAM16076800.212.8
TkA07G084790PF14551MCM_N6376498.6e-0626.8
TkA07G084790PF23191WHD_MCM3_C6977641.1e-0732.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9FL33Arabidopsis thalianasp|Q9FL33|MCM3_ARATH DNA replication licensing factor MCM354.700%Swiss-ProtHigh
B8AZ99Oryza sativa subsp. indicasp|B8AZ99|MCM3_ORYSI DNA replication licensing factor MCM367.200%Swiss-ProtHigh
Q0DHC4Oryza sativa subsp. japonicasp|Q0DHC4|MCM3_ORYSJ DNA replication licensing factor MCM367.200%Swiss-ProtHigh

JBrowse

View in Genome Browser