LXL04_027668 | RubberDandelionOmics

Gene overview

LXL04_027668

Reference: OH-1004 Chr: Chr06 Coordinates: 21527127-21530800 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2304 bp · LXL04_027668|LXL04_027668|OH1004|cDNA

ATGGACATCAGCGAAGAACAAAGGGCTTCCAACAAAAAGGCTTTCAGCGAATTGTTCGACACAAACGATAGTCTAGATGAAGATATCAGGAGCATGATCCACAACCAGCGCCGTCGTTTGATTTTTCAGCTTTCCCACCTCTTTCAACGCGGAGCGGAGGATTTAGCTCGACGGTTACTACAGACTCCTAACGAATATATCCAGTCGCTGTCGGATTTCATAACGGAAAGAACACGGAGCATCGACCCGAAGTTTCTAAA...

CDS

Download CDS FASTA

2304 bp · LXL04_027668|LXL04_027668|OH1004|CDS

ATGGACATCAGCGAAGAACAAAGGGCTTCCAACAAAAAGGCTTTCAGCGAATTGTTCGACACAAACGATAGTCTAGATGAAGATATCAGGAGCATGATCCACAACCAGCGCCGTCGTTTGATTTTTCAGCTTTCCCACCTCTTTCAACGCGGAGCGGAGGATTTAGCTCGACGGTTACTACAGACTCCTAACGAATATATCCAGTCGCTGTCGGATTTCATAACGGAAAGAACACGGAGCATCGACCCGAAGTTTCTAAA...

Protein

Download Protein FASTA

767 aa · LXL04_027668|LXL04_027668|OH1004|PROTEIN

MDISEEQRASNKKAFSELFDTNDSLDEDIRSMIHNQRRRLIFQLSHLFQRGAEDLARRLLQTPNEYIQSLSDFITERTRSIDPKFLKEGEQVLVGFDGPFVSRKVTPRDLLSEFIGSMVKVEGIITKCSLVRPKVVKSVHFCPSTNQFTSREYRDITSTMGLPTGSVYPTRDDNGNLLVTEYGLCNYKDHQTLSMQEVPENSAPGQLPRTVDVIAEDDLVDSCKPGDRVAIVGVYKAIPGKSQGSVNGVFRTVLIANNVY...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_027668`
TK1151 ID	TkA07G084790
OH-1004 ID	LXL04_027668
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_027668

Location Chr06:21527127-21530800 (-)

Description Similar to MCM3: DNA replication licensing factor MCM3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g46280`	Probable component of the MCM2-7 complex (MCM complex) that may function as a DNA helicase and which is essential to undergo a single round of replication initiation and elongation per cell cycle in eukaryotic cells.	Two E2F sites in the Arabidopsis MCM3 promoter have different roles in cell cycle activation and meristematic expression.2002 · DOI: 10.1074/jbc.m205125200

Rice

Reference gene ID	Possible function	Papers / DOI
`Os05g0476200`	Probable component of the MCM2-7 complex (MCM complex) that may function as a DNA helicase and which is essential to undergo a single round of replication initiation and elongation per cell cycle in eukaryotic cells.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_027668 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000727 double-strand break repair via break-induced replication Biological Process

GO:0006271 DNA strand elongation involved in DNA replication Biological Process

GO:1902975 mitotic DNA replication initiation Biological Process

GO:0000347 THO complex Cellular Component

GO:0000785 chromatin Cellular Component

GO:0005634 nucleus Cellular Component

GO:0042555 MCM complex Cellular Component

GO:0003678 DNA helicase activity Molecular Function

GO:0003697 single-stranded DNA binding Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0016887 ATP hydrolysis activity Molecular Function

KEGG gene cross-reference

ath:AT5G46280

dosa:Os05g0476200

zma:542738

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.931

Rank 1 · LXL04_027668 · OH-1004

Cytoplasm0.139

Rank 2 · LXL04_027668 · OH-1004

Mitochondrion0.026

Rank 3 · LXL04_027668 · OH-1004

Cell membrane0.016

Rank 4 · LXL04_027668 · OH-1004

Endoplasmic reticulum0.007

Rank 5 · LXL04_027668 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14551.12MCM_N27-92 aa

PF17207.10MCM_OB108-239 aa

PF00493.30MCM275-498 aa

PF01078.28Mg_chelatase382-449 aa

PF17855.8MCM_lid552-635 aa

PF23191.2WHD_MCM3_C697-764 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_027668	`PF14551.12`	MCM_N	27	92	8.5e-06	26.8
LXL04_027668	`PF17207.10`	MCM_OB	108	239	1.1e-29	103.4
LXL04_027668	`PF00493.30`	MCM	275	498	1.4e-95	319.4
LXL04_027668	`PF01078.28`	Mg_chelatase	382	449	2.3e-09	37.7
LXL04_027668	`PF17855.8`	MCM_lid	552	635	4.2e-27	95.2
LXL04_027668	`PF23191.2`	WHD_MCM3_C	697	764	1.1e-07	32.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FL33`	Arabidopsis thaliana	DNA replication licensing factor MCM3	68.564%	Swiss-Prot	strong database homology
`Q0DHC4`	Oryza sativa subsp. japonica	DNA replication licensing factor MCM3	67.228%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card