TkA07G056430 | RubberDandelionOmics

Gene overview

TkA07G056430

Reference: TK1151 Chr: Chr07 Coordinates: 15015678-15020314 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1702 bp · TkA07G056430|TK1151|cDNA

CGAAAATCATTGAAAATAAATTAAGTAAATTATATAATAAAAAAAAGTAAAGAATAGCGACGGATTAGAAAGGGGAATTCCCTTTGTTGTGTTCCCCCCTCGCCGATCCGTCTCTGATTTACGACTTCACTTACATTGTTTTTCCCCGTCACCACCGAATCACAAAACGTCGCAATTCAAACACATACGAAATTTCATTTTTAAGTATTTGAAGCTGAATCCATGAGTTGCTCAAAGCCCTTCTAAATCGTAAACCCTAA...

CDS

Download CDS FASTA

411 bp · TkA07G056430|TK1151|CDS

ATGATGAAGATCAAAGATAAGAAAGACAGAGGAACTCTTTCAATCAAGGAGGCGTATGAAGAGGCTATTGTTGCTAAGTATGGCGATGATACTAGTTGTTATCCTCTGTTGGATAGTCAAATATGGCTAGAAGTTAGCGGAGGGAAAAAGAAAGGACGCGTTTTTGGATTTGGTTCGATTTCAGATCCGGAGAGCTTTTTGACGGGGACATCAAGTACCGCAACATCCCGAGAGAAAAAAGCTGCGGAAATGGAGGCAAA...

Protein

Download Protein FASTA

136 aa · TkA07G056430|TK1151|PROTEIN

MMKIKDKKDRGTLSIKEAYEEAIVAKYGDDTSCYPLLDSQIWLEVSGGKKKGRVFGFGSISDPESFLTGTSSTATSREKKAAEMEAKAAEMEVKHHKMCEELDAKAAALEVKQKQIDEKYERFEKMFYELQNMRES

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G056430`
TK1151 ID	TkA07G056430
OH-1004 ID	LXL04_013908
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	96.000
Protein coverage (%)	TK1151 91.912 / OH-1004 5.428 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA07G056430`
Location	Chr07:15015678-15020314 (+)
Description	Similar to GLR3.6: Glutamate receptor 3.6
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_013908` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006816 calcium ion transport Biological Process GO:0006874 intracellular calcium ion homeostasis Biological Process GO:0007267 cell-cell signaling Biological Process GO:0009416 response to light stimulus Biological Process GO:0009611 response to wounding Biological Process GO:0009630 gravitropism Biological Process GO:0009864 induced systemic resistance, jasmonic acid mediated signaling pathway Biological Process GO:0019722 calcium-mediated signaling Biological Process GO:0045087 innate immune response Biological Process GO:0050832 defense response to fungus Biological Process GO:0071230 cellular response to amino acid stimulus Biological Process GO:0005886 plasma membrane Cellular Component
KEGG gene cross-reference	ath:AT1G42540 ath:AT3G51480 osa:124544569 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.941

Rank 1 · TkA07G056430 · TK1151

Cytoplasm0.169

Rank 2 · TkA07G056430 · TK1151

Mitochondrion0.016

Rank 3 · TkA07G056430 · TK1151

Cell membrane0.011

Rank 4 · TkA07G056430 · TK1151

Extracellular0.009

Rank 5 · TkA07G056430 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03244PSI_PsaH7-35 aa

PF03004Transposase_2432-63 aa

PF10199Adaptin_binding53-135 aa

PF03244PSI_PsaH59-130 aa

PF28887PilO_N71-92 aa

PF00170bZIP_172-86 aa

PF18004RPN2_C73-133 aa

PF28121VPA126775-129 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G056430	`PF03244`	PSI_PsaH	7	35	0.15	12.3
TkA07G056430	`PF03004`	Transposase_24	32	63	0.00043	21.2
TkA07G056430	`PF10199`	Adaptin_binding	53	135	0.15	13.6
TkA07G056430	`PF03244`	PSI_PsaH	59	130	0.15	12.3
TkA07G056430	`PF28887`	PilO_N	71	92	1.6	9.4
TkA07G056430	`PF00170`	bZIP_1	72	86	0.37	11.6
TkA07G056430	`PF18004`	RPN2_C	73	133	0.25	11.9
TkA07G056430	`PF28121`	VPA1267	75	129	0.15	13.0
TkA07G056430	`PF16326`	ABC_tran_CTD	78	125	0.0042	18.0
TkA07G056430	`PF20667`	Sec10_N	78	130	0.13	13.1
TkA07G056430	`PF06936`	Selenoprotein_S	81	121	0.031	14.9
TkA07G056430	`PF28887`	PilO_N	87	130	1.6	9.4
TkA07G056430	`PF03004`	Transposase_24	91	91	0.00043	21.2
TkA07G056430	`PF00170`	bZIP_1	95	131	0.37	11.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card