RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

LXL04_013908
Reference: OH-1004 Chr: Chr03 Coordinates: 37755933-37774287 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

6912 bp · LXL04_013908|LXL04_013908|OH1004|cDNA

ATGCATCCAAGAGGCTGCTCTTCTCTGGTGTACATGAAGCCAACCTTTTGTAAGAGAATGCCTAAGAATCTAGTTTGGGTATTCCTCTTGTTGATGGTCAATTTCCATGGATGCTTCGCTAAAGGGCTTAATAACACCAGCGTTTCTACAAGACCAAGTGTCGTGAATATTGCATCTATCTTGACATTCGATTCCATAATTGGAAAAGTCGCTAAAATTGCTTTACAAGCTGCAATTGAAGACGTCAACTCTGATCCCAA...

CDS

Download CDS FASTA

6912 bp · LXL04_013908|LXL04_013908|OH1004|CDS

ATGCATCCAAGAGGCTGCTCTTCTCTGGTGTACATGAAGCCAACCTTTTGTAAGAGAATGCCTAAGAATCTAGTTTGGGTATTCCTCTTGTTGATGGTCAATTTCCATGGATGCTTCGCTAAAGGGCTTAATAACACCAGCGTTTCTACAAGACCAAGTGTCGTGAATATTGCATCTATCTTGACATTCGATTCCATAATTGGAAAAGTCGCTAAAATTGCTTTACAAGCTGCAATTGAAGACGTCAACTCTGATCCCAA...

Protein

Download Protein FASTA

2303 aa · LXL04_013908|LXL04_013908|OH1004|PROTEIN

MHPRGCSSLVYMKPTFCKRMPKNLVWVFLLLMVNFHGCFAKGLNNTSVSTRPSVVNIASILTFDSIIGKVAKIALQAAIEDVNSDPNILIGTKLKITLHDSNFSAFMSMMEALQVMETDTVALIGPQSSVLPHVISHVANELQVPLLSFTATDPTLNSLQYPFFVRTTHSDLYQMAAIADIIKYYEWRKVTAIYFDDDHGRNGIISLGDQLASRGCEISHKAPIKPLATKSDISDVLVQVALMESRILVVHTYPHYGLDI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDLXL04_013908
Source versionOH-1004 / GCA_047496595.1_OSU_TarKok_2.0
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDLXL04_013908
LocationChr03:37755933-37774287 (+)
DescriptionSimilar to GLR3.6: Glutamate receptor 3.6
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At3g51480 Glutamate-gated receptor that probably acts as a non- selective cation channel.
GLUTAMATE RECEPTOR-LIKE genes mediate leaf-to-leaf wound signalling.2013 · DOI: 10.1038/nature12478
At1g42540 Glutamate-gated receptor that probably acts as a non-selective cation channel, at least in roots and hypocotyls (Probable).
Calcium entry mediated by GLR3.3, an Arabidopsis glutamate receptor with a broad agonist profile.2006 · DOI: 10.1104/pp.106.088989
Glutamate receptor subtypes evidenced by differences in desensitization and dependence on the GLR3.3 and GLR3.4 genes.2008 · DOI: 10.1104/pp.107.108134
Glutamate receptor-like channel3.3 is involved in mediating glutathione-triggered cytosolic calcium transients, transcriptional changes, and innate immunity responses in Arabidopsis.2013 · DOI: 10.1104/pp.113.217208
Involvement of the glutamate receptor AtGLR3.3 in plant defense signaling and resistance to Hyaloperonospora arabidopsidis.2013 · DOI: 10.1111/tpj.12311
GLUTAMATE RECEPTOR-LIKE genes mediate leaf-to-leaf wound signalling.2013 · DOI: 10.1038/nature12478
Real-time, in vivo intracellular recordings of caterpillar-induced depolarization waves in sieve elements using aphid electrodes.2014 · DOI: 10.1111/nph.12807
At4g35290 Glutamate-gated receptor that probably acts as a non-selective cation channel (Probable).
Overexpression of the AtGluR2 gene encoding an Arabidopsis homolog of mammalian glutamate receptors impairs calcium utilization and sensitivity to ionic stress in transgenic plants.2001 · DOI: 10.1093/pcp/pce008
Interacting glutamate receptor-like proteins in Phloem regulate lateral root initiation in Arabidopsis.2013 · DOI: 10.1105/tpc.113.110668
At2g17260 Glutamate-gated receptor that probably acts as a non- selective cation channel.
De-regulated expression of the plant glutamate receptor homolog AtGLR3.1 impairs long-term Ca2+-programmed stomatal closure.2009 · DOI: 10.1111/j.1365-313x.2009.03789.x

Rice

Reference gene IDPossible functionPapers / DOI
Os04g0585200 Glutamate-gated receptor that probably acts as a non-selective cation channel.
A rice glutamate receptor-like gene is critical for the division and survival of individual cells in the root apical meristem.2006 · DOI: 10.1105/tpc.105.037713
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_013908 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)
GO:0006816 calcium ion transport Biological Process
GO:0006874 intracellular calcium ion homeostasis Biological Process
GO:0007267 cell-cell signaling Biological Process
GO:0009416 response to light stimulus Biological Process
GO:0009611 response to wounding Biological Process
GO:0009630 gravitropism Biological Process
GO:0009864 induced systemic resistance, jasmonic acid mediated signaling pathway Biological Process
GO:0019722 calcium-mediated signaling Biological Process
GO:0045087 innate immune response Biological Process
GO:0050832 defense response to fungus Biological Process
GO:0071230 cellular response to amino acid stimulus Biological Process
GO:0005886 plasma membrane Cellular Component
KEGG gene cross-reference
ath:AT1G42540
ath:AT3G51480
osa:124544569
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.747
Rank 1 · LXL04_013908 · OH-1004
Endoplasmic reticulum0.099
Rank 2 · LXL04_013908 · OH-1004
Cytoplasm0.073
Rank 3 · LXL04_013908 · OH-1004
Lysosome / Vacuole0.071
Rank 4 · LXL04_013908 · OH-1004
Nucleus0.040
Rank 5 · LXL04_013908 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13458.13Peripla_BP_666-351 aa
PF01094.35ANF_receptor72-425 aa
PF10613.15Lig_chan-Glu_bd500-587 aa
PF00497.26SBP_bac_3542-824 aa
PF00060.33Lig_chan606-857 aa
PF22794.2jr-ZPR1991-1098 aa
PF03367.20Zn_ribbon_ZPR11147-1202 aa
PF22794.2jr-ZPR11216-1249 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
LXL04_013908PF13458.13Peripla_BP_6663512.9e-28100.2
LXL04_013908PF01094.35ANF_receptor724255.6e-174578.9
LXL04_013908PF10613.15Lig_chan-Glu_bd5005879.6e-1968.3
LXL04_013908PF00497.26SBP_bac_35428245.9e-2485.0
LXL04_013908PF00060.33Lig_chan6068572.7e-75251.8
LXL04_013908PF22794.2jr-ZPR199110981.1e-46158.5
LXL04_013908PF03367.20Zn_ribbon_ZPR1114712027.3e-2586.9
LXL04_013908PF22794.2jr-ZPR1121612491.1e-46158.5
LXL04_013908PF13458.13Peripla_BP_6142517092.9e-28100.2
LXL04_013908PF01094.35ANF_receptor143117845.6e-174578.9
LXL04_013908PF10613.15Lig_chan-Glu_bd185919449.6e-1968.3
LXL04_013908PF00497.26SBP_bac_3186121815.9e-2485.0
LXL04_013908PF00060.33Lig_chan196322132.7e-75251.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q84W41Arabidopsis thalianaGlutamate receptor 3.660.000%Swiss-Protweak database homology
Q9C8E7Arabidopsis thalianaGlutamate receptor 3.356.536%Swiss-Protweak database homology
Q93YT1Arabidopsis thalianaGlutamate receptor 3.253.070%Swiss-Protweak database homology
Q7XJL2Arabidopsis thalianaGlutamate receptor 3.154.218%Swiss-Protweak database homology
Q7XP59Oryza sativa subsp. japonicaGlutamate receptor 3.152.643%Swiss-Protweak database homology

JBrowse

View in Genome Browser