Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1877 bp · TkA07G041010|TK1151|cDNA
AAAACGCGAACGTAGCAAAAGGAAAGCGTATCAATCTTTTTCCCCGAAAGCTTTTCTTTTCCCCTAAATTGAAATTCCCTTCTCCAAGGCACTAACGTCTACACTCTCCTTCGTCGTCTTCTTTCTCTTGGTTTCCATCAGTGTGTTTTGGAAGATTTAACAGAGAAAAATGGCAGTGAAAGATTTGAAGTCAAAGCAAGAGCTTGATACTCTTGTGAATGAAGGGTCGCCTGTCATGATTCACTTCTGGGCTTCATGGT...
1470 bp · TkA07G041010|TK1151|CDS
ATGGCAGTGAAAGATTTGAAGTCAAAGCAAGAGCTTGATACTCTTGTGAATGAAGGGTCGCCTGTCATGATTCACTTCTGGGCTTCATGGTGTGAAGCTTCTAAGCACATGGATCAAGTCTTTTCTCATCTTTCCACTGATTTCCCTCATGCTCATTTCCTAAGGGTTGAAGCTGAAGAACAACCAGAAATATCCGAAGCATATTCAGTTTCCGCTGTCCCATACTTCGCTTTTATCAAGGGTGGCAAGATGGTTGACAC...
Protein
Download Protein FASTA489 aa · TkA07G041010|TK1151|PROTEIN
MAVKDLKSKQELDTLVNEGSPVMIHFWASWCEASKHMDQVFSHLSTDFPHAHFLRVEAEEQPEISEAYSVSAVPYFAFIKGGKMVDTLEGAYPSELANKIAKVVGSIHAGEPAAPASLGMAAGPTILQAIQEIAKTDTSSTTNSHSRPPNTGVTDTLKSRLEKLTRAHPIMLFMKGNPEDPKCGFSKKAVEILRAENVKFGTFDILGDNEVREGLKKFSNWPTYPQLYCKGELLGGSDIIIAMHEGGELKQAFQDRGVGD...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA07G041010 |
|---|---|
| TK1151 ID | TkA07G041010 |
| OH-1004 ID | LXL04_002029 |
| Relationship / confidence | Non Reciprocal Best Hit / Complex relationship |
| Protein identity (%) | 45.500 |
| Protein coverage (%) | TK1151 20.245 / OH-1004 60.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA07G041010 | ||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr07:10977353-10980595 (+) | ||||||||||||
| Description | Similar to GRXS15: Monothiol glutaredoxin-S15, mitochondrial | ||||||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
Rice
| ||||||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | ||||||||||||
| GO annotations (OH1004 source) | GO:0006879 intracellular iron ion homeostasis Biological Process GO:0009249 protein lipoylation Biological Process GO:0016226 iron-sulfur cluster assembly Biological Process GO:0044571 [2Fe-2S] cluster assembly Biological Process GO:0045454 cell redox homeostasis Biological Process GO:0051604 protein maturation Biological Process GO:0005739 mitochondrion Cellular Component GO:0005759 mitochondrial matrix Cellular Component GO:0005829 cytosol Cellular Component GO:1990229 iron-sulfur cluster assembly complex Cellular Component GO:0015036 disulfide oxidoreductase activity Molecular Function GO:0046872 metal ion binding Molecular Function | ||||||||||||
| KEGG gene cross-reference | ath:AT3G15660 dosa:Os01g0174900 dosa:Os01g0530400 hsa:51218 mmu:73046 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00085Thioredoxin8-101 aaPF13098Thioredoxin_210-97 aaPF13899Thioredoxin_715-43 aaPF13905Thioredoxin_820-48 aaPF00462Glutaredoxin26-74 aaPF07449HyaE40-92 aaPF13905Thioredoxin_850-77 aaPF13417GST_N_357-88 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA07G041010 | PF00085 | Thioredoxin | 8 | 101 | 1.7e-15 | 57.6 |
| TkA07G041010 | PF13098 | Thioredoxin_2 | 10 | 97 | 4.3e-06 | 27.7 |
| TkA07G041010 | PF13899 | Thioredoxin_7 | 15 | 43 | 0.037 | 14.9 |
| TkA07G041010 | PF13905 | Thioredoxin_8 | 20 | 48 | 0.24 | 12.5 |
| TkA07G041010 | PF00462 | Glutaredoxin | 26 | 74 | 1.1e-61 | 205.6 |
| TkA07G041010 | PF07449 | HyaE | 40 | 92 | 0.081 | 13.7 |
| TkA07G041010 | PF13905 | Thioredoxin_8 | 50 | 77 | 0.24 | 12.5 |
| TkA07G041010 | PF13417 | GST_N_3 | 57 | 88 | 1.4e-08 | 35.6 |
| TkA07G041010 | PF22724 | NCAB1 | 156 | 219 | 0.00091 | 20.0 |
| TkA07G041010 | PF07449 | HyaE | 158 | 178 | 0.081 | 13.7 |
| TkA07G041010 | PF13098 | Thioredoxin_2 | 169 | 189 | 4.3e-06 | 27.7 |
| TkA07G041010 | PF00462 | Glutaredoxin | 170 | 233 | 1.1e-61 | 205.6 |
| TkA07G041010 | PF13417 | GST_N_3 | 181 | 242 | 1.4e-08 | 35.6 |
| TkA07G041010 | PF00025 | Arf | 181 | 216 | 0.22 | 11.7 |
| TkA07G041010 | PF04908 | SH3BGR | 188 | 219 | 2.7e-07 | 31.4 |
| TkA07G041010 | PF17353 | DUF5381 | 190 | 217 | 0.19 | 12.0 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.