TkA06G458630 | RubberDandelionOmics

Gene overview

TkA06G458630

Reference: TK1151 Chr: Chr06 Coordinates: 113477745-113479163 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

615 bp · TkA06G458630|TK1151|cDNA

ATGATCGGAGTAAAAACCCTAAGGTATAATTTGGGGGCAATTGTTATGGGTCAGGATCCTGAATGGTATACCAGGATCCCGGATCTTAGACTGACAGTTATCAACACGTCTGAAGACTCGTTCAAAGGCGGCATAAAATCCGGAACTAAGCCGTTAATATCCGTTGAAGACTCAACCAAAACAGCAACTGGCCAAACTCCTTATTCTTTGGTGTTTGGGACTGAAGCCGTGATCCCAACTGACGTAGTGATTCCAACAGC...

CDS

Download CDS FASTA

615 bp · TkA06G458630|TK1151|CDS

ATGATCGGAGTAAAAACCCTAAGGTATAATTTGGGGGCAATTGTTATGGGTCAGGATCCTGAATGGTATACCAGGATCCCGGATCTTAGACTGACAGTTATCAACACGTCTGAAGACTCGTTCAAAGGCGGCATAAAATCCGGAACTAAGCCGTTAATATCCGTTGAAGACTCAACCAAAACAGCAACTGGCCAAACTCCTTATTCTTTGGTGTTTGGGACTGAAGCCGTGATCCCAACTGACGTAGTGATTCCAACAGC...

Protein

Download Protein FASTA

204 aa · TkA06G458630|TK1151|PROTEIN

MIGVKTLRYNLGAIVMGQDPEWYTRIPDLRLTVINTSEDSFKGGIKSGTKPLISVEDSTKTATGQTPYSLVFGTEAVIPTDVVIPTARYQLQDPQYNNRILTEDLDTIDELRDLAKVRIAAHQQRIANSYNKNIKIQRFQVGDLVLRKTFQNKKDPSAGKLAPKWEGPYFIDLKAGKVAYWLANMEGVLLPRSWNAIHLKSYFM

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G458630`
TK1151 ID	TkA06G458630
OH-1004 ID	LXL04_025061
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	84.800
Protein coverage (%)	TK1151 71.078 / OH-1004 25.939 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA06G458630`
Location	Chr06:113477745-113479163 (-)
Description	Similar to pol: Gag-Pol polyprotein (Fragment)
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_025061` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006310 DNA recombination Biological Process GO:0006508 proteolysis Biological Process GO:0015074 DNA integration Biological Process GO:0019068 virion assembly Biological Process GO:0039657 symbiont-mediated suppression of host gene expression Biological Process GO:0044826 viral genome integration into host DNA Biological Process GO:0046718 symbiont entry into host cell Biological Process GO:0075713 establishment of integrated proviral latency Biological Process GO:0005634 nucleus Cellular Component GO:0019013 viral nucleocapsid Cellular Component GO:0020002 host cell plasma membrane Cellular Component GO:0044185 host cell late endosome membrane Cellular Component
KEGG gene cross-reference	bta:504972 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.341

Rank 1 · TkA06G458630 · TK1151

Mitochondrion0.268

Rank 2 · TkA06G458630 · TK1151

Nucleus0.133

Rank 3 · TkA06G458630 · TK1151

Peroxisome0.098

Rank 4 · TkA06G458630 · TK1151

Plastid0.086

Rank 5 · TkA06G458630 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF10377ATG11123-186 aa

PF18697MLVIN_C138-172 aa

PF31073DUF8803139-203 aa

PF24626SH3_Tf2-1142-183 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G458630	`PF10377`	ATG11	123	186	0.17	12.7
TkA06G458630	`PF18697`	MLVIN_C	138	172	0.042	14.2
TkA06G458630	`PF31073`	DUF8803	139	203	1.1e-24	86.7
TkA06G458630	`PF24626`	SH3_Tf2-1	142	183	0.00018	22.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card