TkA06G155190 | RubberDandelionOmics

Gene overview

TkA06G155190

Reference: TK1151 Chr: Chr06 Coordinates: 40985874-40986437 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

486 bp · TkA06G155190|TK1151|cDNA

TTCAAATTGATAATGATTGAGGTGAAGTTTGATTAAGCTTCAATGTCTCCTCCATTTTCTCTTCCTCTCGCAGCTGAAAATGAATATTGGATAGATGAAGGCATCTTTACGTCCTTACAGAATTTCAAAACAGAAAAACCGCTACCTGCAAATGTAGATTCGGAACTAAATCCTTATCAGTATCGGCCCCAAGATCTACCTGGTGATCTGTGGTACTTTTGTTCGACGGTGAAAAAAGAATCAGATATCGGATTCTGGCA...

CDS

Download CDS FASTA

444 bp · TkA06G155190|TK1151|CDS

ATGTCTCCTCCATTTTCTCTTCCTCTCGCAGCTGAAAATGAATATTGGATAGATGAAGGCATCTTTACGTCCTTACAGAATTTCAAAACAGAAAAACCGCTACCTGCAAATGTAGATTCGGAACTAAATCCTTATCAGTATCGGCCCCAAGATCTACCTGGTGATCTGTGGTACTTTTGTTCGACGGTGAAAAAAGAATCAGATATCGGATTCTGGCAGGAAACAGGGGAGCCATGCGAGATATTCTCTAATTCCGCCAT...

Protein

Download Protein FASTA

148 aa · TkA06G155190|TK1151|PROTEIN

MSPPFSLPLAAENEYWIDEGIFTSLQNFKTEKPLPANVDSELNPYQYRPQDLPGDLWYFCSTVKKESDIGFWQETGEPCEIFSNSAISGFRTTLRFYEGNTPHGRKTDWVMQEYRITVENDDHRALCRVYLAVENSPKMECFLPEAIL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G155190`
TK1151 ID	TkA06G155190
OH-1004 ID	LXL04_024318
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 95.946 / OH-1004 68.269 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G155190

Location Chr06:40985874-40986437 (-)

Description Similar to NAP2: NAC domain-containing protein 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g71930`	May bind promoters of secondary cell-wall genes and activate transcription.	Transcription switches for protoxylem and metaxylem vessel formation.2005 · DOI: 10.1101/gad.1331305 Vascular-related NAC-DOMAIN7 is involved in the differentiation of all types of xylem vessels in Arabidopsis roots and shoots.2008 · DOI: 10.1111/j.1365-313x.2008.03533.x A battery of transcription factors involved in the regulation of secondary cell wall biosynthesis in Arabidopsis.2008 · DOI: 10.1105/tpc.108.061325 ASYMMETRIC LEAVES2-LIKE19/LATERAL ORGAN BOUNDARIES DOMAIN30 and ASL20/LBD18 regulate tracheary element differentiation in Arabidopsis.2008 · DOI: 10.1105/tpc.108.061796 MYB58 and MYB63 are transcriptional activators of the lignin biosynthetic pathway during secondary cell wall formation in Arabidopsis.2009 · DOI: 10.1105/tpc.108.063321 MYB83 is a direct target of SND1 and acts redundantly with MYB46 in the regulation of secondary cell wall biosynthesis in Arabidopsis.2009 · DOI: 10.1093/pcp/pcp139 VASCULAR-RELATED NAC-DOMAIN6 and VASCULAR-RELATED NAC-DOMAIN7 effectively induce transdifferentiation into xylem vessel elements under control of an induction system.2010 · DOI: 10.1104/pp.110.154013 Global analysis of direct targets of secondary wall NAC master switches in Arabidopsis.2010 · DOI: 10.1093/mp/ssq062 VASCULAR-RELATED NAC-DOMAIN7 directly regulates the expression of a broad range of genes for xylem vessel formation.2011 · DOI: 10.1111/j.1365-313x.2011.04514.x The Arabidopsis thaliana checkpoint kinase WEE1 protects against premature vascular differentiation during replication stress.2011 · DOI: 10.1105/tpc.110.082768 Verticillium infection triggers VASCULAR-RELATED NAC DOMAIN7-dependent de novo xylem formation and enhances drought tolerance in Arabidopsis.2012 · DOI: 10.1105/tpc.112.103374
`At2g18060`	Transcription activator that binds to the secondary wall NAC binding element (SNBE), 5'-(T/A)NN(C/T)(T/C/G)TNNNNNNNA(A/C)GN(A/C/T)(A/T)-3', in the promoter of target genes (By similarity).	Arabidopsis NAC domain proteins, VND1 to VND5, are transcriptional regulators of secondary wall biosynthesis in vessels.2014 · DOI: 10.1371/journal.pone.0105726
`At1g56010`	Transcriptional activator that mediates auxin signaling to promote lateral root development.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os06g0530400`	Probable transcription factor involved in stress response.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_024318 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006979 response to oxidative stress Biological Process

GO:0009646 response to absence of light Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009723 response to ethylene Biological Process

GO:0009733 response to auxin Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009819 drought recovery Biological Process

GO:0009834 plant-type secondary cell wall biogenesis Biological Process

GO:0010029 regulation of seed germination Biological Process

KEGG gene cross-reference

ath:AT2G33480

ath:AT3G10500

ath:AT5G39610

dosa:Os06g0530400

sly:101248665

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.840

Rank 1 · TkA06G155190 · TK1151

Cytoplasm0.192

Rank 2 · TkA06G155190 · TK1151

Cell membrane0.049

Rank 3 · TkA06G155190 · TK1151

Endoplasmic reticulum0.038

Rank 4 · TkA06G155190 · TK1151

Plastid0.025

Rank 5 · TkA06G155190 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02365NAM24-116 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G155190	`PF02365`	NAM	24	116	1.5e-14	55.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C8W9`	Arabidopsis thaliana	sp\|Q9C8W9\|NAC30_ARATH NAC domain-containing protein 30	31.300%	Swiss-Prot	Medium
`Q9SL41`	Arabidopsis thaliana	sp\|Q9SL41\|NAC37_ARATH NAC domain-containing protein 37	30.300%	Swiss-Prot	Medium
`Q84TE6`	Arabidopsis thaliana	sp\|Q84TE6\|NAC22_ARATH NAC domain-containing protein 21/22	36.900%	Swiss-Prot	Low
`Q5Z6B6`	Oryza sativa subsp. japonica	sp\|Q5Z6B6\|NAC76_ORYSJ NAC domain-containing protein 76	39.400%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card