LXL04_024318 | RubberDandelionOmics

Gene overview

LXL04_024318

Reference: OH-1004 Chr: Chr05 Coordinates: 87293961-87294665 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

627 bp · LXL04_024318|LXL04_024318|OH1004|cDNA

ATGTCTCCTCCATTTTCTCTTCCTCTCGCAGCTGAAAATGAATATTGGATAGATGAAGGCATCTTTACGTCCTTACAGAATTTCAAAACAGAAAAACCGCTACCTGCAAATGTAGATTCGGAACTAAATCCTTATCAGTATCGGCCCCAAGATCTACCTGGTGATCTGTGGTACTTTTGTTCGACGGTGAAAAAAGAATCAGATATCGGATTCTGGCAGGAAACAGGGGAGCCATGCGAGATATTCTCTAATTCCGCCAT...

CDS

Download CDS FASTA

627 bp · LXL04_024318|LXL04_024318|OH1004|CDS

ATGTCTCCTCCATTTTCTCTTCCTCTCGCAGCTGAAAATGAATATTGGATAGATGAAGGCATCTTTACGTCCTTACAGAATTTCAAAACAGAAAAACCGCTACCTGCAAATGTAGATTCGGAACTAAATCCTTATCAGTATCGGCCCCAAGATCTACCTGGTGATCTGTGGTACTTTTGTTCGACGGTGAAAAAAGAATCAGATATCGGATTCTGGCAGGAAACAGGGGAGCCATGCGAGATATTCTCTAATTCCGCCAT...

Protein

Download Protein FASTA

208 aa · LXL04_024318|LXL04_024318|OH1004|PROTEIN

MSPPFSLPLAAENEYWIDEGIFTSLQNFKTEKPLPANVDSELNPYQYRPQDLPGDLWYFCSTVKKESDIGFWQETGEPCEIFSNSAISGFRTTLRFYEGNTPHGRKTDWVMQEYRITVENDDHRALCRVYLAVENSPKMECFFTGGYLELNNLIDDSGRSSMSTNSSCLTMTSDEYFDSMALRQLSTNSSREGIRVRPKTRTEWQKLG

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_024318`
TK1151 ID	TkA06G155190
OH-1004 ID	LXL04_024318
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 95.946 / OH-1004 68.269 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_024318

Location Chr05:87293961-87294665 (+)

Description Similar to NAP2: NAC domain-containing protein 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g10500`	Transcriptional activator activated by proteolytic cleavage through regulated intramembrane proteolysis (RIP).	A NAC transcription factor NTL4 promotes reactive oxygen species production during drought-induced leaf senescence in Arabidopsis.2012 · DOI: 10.1111/j.1365-313x.2012.04932.x The Arabidopsis NAC transcription factor NTL4 participates in a positive feedback loop that induces programmed cell death under heat stress conditions.2014 · DOI: 10.1016/j.plantsci.2014.07.003
`At5g39610`	Transcription activator that binds to DNA in promoters of target genes on a specific bipartite motif 5'-[ACG][CA]GT[AG](5-6n)[CT]AC[AG]-3'.	The delayed leaf senescence mutants of Arabidopsis, ore1, ore3, and ore9 are tolerant to oxidative stress.2004 · DOI: 10.1093/pcp/pch110 Trifurcate feed-forward regulation of age-dependent cell death involving miR164 in Arabidopsis.2009 · DOI: 10.1126/science.1166386 Forward and reverse genetics to identify genes involved in the age-related resistance response in Arabidopsis thaliana.2009 · DOI: 10.1111/j.1364-3703.2009.00557.x A gene regulatory network controlled by the NAC transcription factor ANAC092/AtNAC2/ORE1 during salt-promoted senescence.2010 · DOI: 10.1111/j.1365-313x.2010.04151.x ORS1, an H₂O₂-responsive NAC transcription factor, controls senescence in Arabidopsis thaliana.2011 · DOI: 10.1093/mp/ssq080 NAC transcription factor ORE1 and senescence-induced BIFUNCTIONAL NUCLEASE1 (BFN1) constitute a regulatory cascade in Arabidopsis.2013 · DOI: 10.1093/mp/sst012 ORE1 balances leaf senescence against maintenance by antagonizing G2-like-mediated transcription.2013 · DOI: 10.1038/embor.2013.24
`At2g33480`	Transcription activator of the mannan synthase CSLA9.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os06g0530400`	Probable transcription factor involved in stress response.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_024318 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006979 response to oxidative stress Biological Process

GO:0009646 response to absence of light Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009723 response to ethylene Biological Process

GO:0009733 response to auxin Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009819 drought recovery Biological Process

GO:0009834 plant-type secondary cell wall biogenesis Biological Process

GO:0010029 regulation of seed germination Biological Process

KEGG gene cross-reference

ath:AT2G33480

ath:AT3G10500

ath:AT5G39610

dosa:Os06g0530400

sly:101248665

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.872

Rank 1 · LXL04_024318 · OH-1004

Cytoplasm0.175

Rank 2 · LXL04_024318 · OH-1004

Cell membrane0.059

Rank 3 · LXL04_024318 · OH-1004

Endoplasmic reticulum0.038

Rank 4 · LXL04_024318 · OH-1004

Plastid0.023

Rank 5 · LXL04_024318 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02365.21NAM24-116 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_024318	`PF02365.21`	NAM	24	116	3.2e-14	54.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q949N0`	Arabidopsis thaliana	NAC domain-containing protein 53	31.818%	Swiss-Prot	moderate database homology
`Q9FKA0`	Arabidopsis thaliana	NAC domain-containing protein 92	29.240%	Swiss-Prot	weak database homology
`O22798`	Arabidopsis thaliana	NAC domain-containing protein 41	32.836%	Swiss-Prot	moderate database homology
`Q5Z6B6`	Oryza sativa subsp. japonica	NAC domain-containing protein 76	39.362%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card