TkA06G041020 | RubberDandelionOmics

Gene overview

TkA06G041020

Reference: TK1151 Chr: Chr06 Coordinates: 11091347-11092465 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1053 bp · TkA06G041020|TK1151|cDNA

ATGTTGAGGGAAGACGACAAATCACAGCCGCCGCCTCTACCTGCAGCTACCGGAGGAGGAAAAATATACTCCAGGTCAGTTTCCTGGGCCGGCAAGGCAAGGGCATGTCTGCCGCCGTTACAGCCTCTCTCGGTTTCTCGGCCGAAGGCCGAGGAGTGGCCAAGGGCGGGCTCCGACGATCTCGGAGTTTGGCCGAATGTCACCGCTACTACTCCCGGCGCTAGACCTAGACCTCCTTCTCTACCTCAGTGTTCTCGAAT...

CDS

Download CDS FASTA

1053 bp · TkA06G041020|TK1151|CDS

ATGTTGAGGGAAGACGACAAATCACAGCCGCCGCCTCTACCTGCAGCTACCGGAGGAGGAAAAATATACTCCAGGTCAGTTTCCTGGGCCGGCAAGGCAAGGGCATGTCTGCCGCCGTTACAGCCTCTCTCGGTTTCTCGGCCGAAGGCCGAGGAGTGGCCAAGGGCGGGCTCCGACGATCTCGGAGTTTGGCCGAATGTCACCGCTACTACTCCCGGCGCTAGACCTAGACCTCCTTCTCTACCTCAGTGTTCTCGAAT...

Protein

Download Protein FASTA

350 aa · TkA06G041020|TK1151|PROTEIN

MLREDDKSQPPPLPAATGGGKIYSRSVSWAGKARACLPPLQPLSVSRPKAEEWPRAGSDDLGVWPNVTATTPGARPRPPSLPQCSRIIDHVFLGSDAVAKNRDVLRQNGITHVLNCVGFVCPEYFNTDLVYKTLWLQDSPSEDITSILYDVFDYFEDVREQNGRVFVHCCQGVSRSTSLVIAYLMWREGHSFEDAFQQVKAARGVTNPNMGFASQLLQCQKRVHAVPVSPSSVLRMYRIAPHSSYAPLHLVPKLLHKPSE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G041020`
TK1151 ID	TkA06G041020
OH-1004 ID	LXL04_025801
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	93.500
Protein coverage (%)	TK1151 100.000 / OH-1004 52.991 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G041020

Location Chr06:11091347-11092465 (-)

Description Similar to MKP1: Protein-tyrosine-phosphatase MKP1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g55270`	Protein-tyrosine-phosphatase that acts as a negative regulator of MPK6 and MPK3 signaling by dephosphorylating and repressing MPK6 and MPK3.	Mitogen-activated protein kinase phosphatase is required for genotoxic stress relief in Arabidopsis.2001 · DOI: 10.1101/gad.192601 Distinct regulation of salinity and genotoxic stress responses by Arabidopsis MAP kinase phosphatase 1.2002 · DOI: 10.1093/emboj/cdf646 The role of NADPH oxidase and MAP kinase phosphatase in UV-B-dependent gene expression in Arabidopsis.2006 · DOI: 10.1111/j.1365-3040.2006.01555.x MAP kinase phosphatase1 and protein tyrosine phosphatase1 are repressors of salicylic acid synthesis and SNC1-mediated responses in Arabidopsis.2009 · DOI: 10.1105/tpc.109.067678 Arabidopsis MAP Kinase Phosphatase 1 (AtMKP1) negatively regulates MPK6-mediated PAMP responses and resistance against bacteria.2011 · DOI: 10.1111/j.1365-313x.2011.04588.x Arabidopsis MAP kinase phosphatase 1 is phosphorylated and activated by its substrate AtMPK6.2011 · DOI: 10.1007/s00299-011-1064-4 Arabidopsis MAP kinase phosphatase 1 and its target MAP kinases 3 and 6 antagonistically determine UV-B stress tolerance, independent of the UVR8 photoreceptor pathway.2011 · DOI: 10.1111/j.1365-313x.2011.04725.x
`At3g06110`	Has a dual specificity toward Ser/Thr and Tyr-containing proteins.	Arabidopsis MAPK phosphatase 2 (MKP2) positively regulates oxidative stress tolerance and inactivates the MPK3 and MPK6 MAPKs.2007 · DOI: 10.1074/jbc.m701888200 MAPK phosphatase MKP2 mediates disease responses in Arabidopsis and functionally interacts with MPK3 and MPK6.2010 · DOI: 10.1111/j.1365-313x.2010.04297.x Regulation of MAPK signaling and cell death by MAPK phosphatase MKP2.2010 · DOI: 10.4161/psb.5.11.13645

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025801 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006470 protein dephosphorylation Biological Process

GO:0006952 defense response Biological Process

GO:0006979 response to oxidative stress Biological Process

GO:0009651 response to salt stress Biological Process

GO:0010193 response to ozone Biological Process

GO:0010224 response to UV-B Biological Process

GO:0010225 response to UV-C Biological Process

GO:0016311 dephosphorylation Biological Process

GO:0034051 negative regulation of plant-type hypersensitive response Biological Process

GO:0034599 cellular response to oxidative stress Biological Process

GO:0035556 intracellular signal transduction Biological Process

GO:0070373 negative regulation of ERK1 and ERK2 cascade Biological Process

KEGG gene cross-reference

ath:AT3G06110

ath:AT3G55270

gga:395642

hsa:1846

rno:60587

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.637

Rank 1 · TkA06G041020 · TK1151

Nucleus0.313

Rank 2 · TkA06G041020 · TK1151

Cell membrane0.121

Rank 3 · TkA06G041020 · TK1151

Golgi apparatus0.075

Rank 4 · TkA06G041020 · TK1151

Mitochondrion0.074

Rank 5 · TkA06G041020 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00782DSPc91-221 aa

PF22785Tc-R-P95-187 aa

PF00102Y_phosphatase135-191 aa

PF22741PTP-NADK158-198 aa

PF00626Gelsolin259-323 aa

PF25480DUF7904275-327 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G041020	`PF00782`	DSPc	91	221	5.5e-28	98.1
TkA06G041020	`PF22785`	Tc-R-P	95	187	0.00018	22.7
TkA06G041020	`PF00102`	Y_phosphatase	135	191	0.00055	20.3
TkA06G041020	`PF22741`	PTP-NADK	158	198	0.01	16.0
TkA06G041020	`PF00626`	Gelsolin	259	323	0.0027	18.2
TkA06G041020	`PF25480`	DUF7904	275	327	0.00067	20.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C5S1`	Arabidopsis thaliana	sp\|Q9C5S1\|MKP1_ARATH Protein-tyrosine-phosphatase MKP1	58.200%	Swiss-Prot	High
`Q9M8K7`	Arabidopsis thaliana	sp\|Q9M8K7\|DUS1B_ARATH Dual specificity protein phosphatase 1B	37.400%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card