TkA05G465980 | RubberDandelionOmics

Gene overview

TkA05G465980

Reference: TK1151 Chr: Chr05 Coordinates: 116831940-116835137 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2366 bp · TkA05G465980|TK1151|cDNA

TTTGACTCGGTGCCGAGGCGACCAAAACACCCCATCGTCGTCGCCGTACCCCTTCCCTCCTCCCATGTCAGCGCCGCTTTCCTTGGACATCCTCATTCAGAAACTGAATATCACAGAGACGATGAATTAGTTGAGGGTTTTGCTAAAAAGGCTAAGGAGGTCTAAGAGTAATTCATTCTGTTTTCCTCCCACAAAAGATGCTGCCAAGAGCATAATAGCAAGTTCACTTTTAGGAAGCTGACGGAAGGCGTATGATTGTT...

CDS

Download CDS FASTA

2370 bp · TkA05G465980|TK1151|CDS

ATGTTGCCTCCTCTCATCAGGTTAGCGTCTTGCCGTAATTTGGTAAAAAAATCCTTAAATCTCTGTTCTTTATCCGTTTCATCGCTTGTACAGTCACCCTGTTCCGATGCGTCAGACTCATCTTCTGATGATAACAATACCAATTTGCTTTCTCGACCGCTTGATAAACTCGATAAGTTTGAAGTTATCGAAACCTTGCACAAGTTAAACAGAGAACCCAACATTGCGCTATCATTTATTACGCAACTGAAAGAATCTGG...

Protein

Download Protein FASTA

789 aa · TkA05G465980|TK1151|PROTEIN

MLPPLIRLASCRNLVKKSLNLCSLSVSSLVQSPCSDASDSSSDDNNTNLLSRPLDKLDKFEVIETLHKLNREPNIALSFITQLKESGFKHDVVTYMAIVRFLCHWGMDIRLDSMFKDVIDNNNRKLLSFEISDLCDALIEEAEMEGMEKLTKAIDVLVKVYASVGRFEEAIDIFYKIKRGKLVLSTRTCNYLMNQLIEFGKLDMVESVYRQLKMKGLIPNVYTFGILIKALCRKGSWKEAIVVFTQMKEAGVESNAFTFG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G465980`
TK1151 ID	TkA05G465980
OH-1004 ID	LXL04_022413
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G465980

Location Chr05:116831940-116835137 (+)

Description Similar to At2g26790: Pentatricopeptide repeat-containing protein At2g26790, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g26790`	Pentatricopeptide repeat-containing protein At2g26790, mitochondrial.	No verified direct reference in this release
`At1g13800`	Putative pentatricopeptide repeat-containing protein At1g13800.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_022413 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0005739 mitochondrion Cellular Component

KEGG gene cross-reference

ath:AT1G13800

ath:AT2G26790

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.838

Rank 1 · TkA05G465980 · TK1151

Plastid0.086

Rank 2 · TkA05G465980 · TK1151

Nucleus0.050

Rank 3 · TkA05G465980 · TK1151

Cytoplasm0.038

Rank 4 · TkA05G465980 · TK1151

Cell membrane0.013

Rank 5 · TkA05G465980 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13041PPR_270-104 aa

PF08967ENCP480-93 aa

PF13812PPR_382-101 aa

PF12854PPR_187-103 aa

PF01535PPR93-120 aa

PF10602RPN7129-183 aa

PF08967ENCP4130-148 aa

PF24760TPR_IF140_C132-175 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G465980	`PF13041`	PPR_2	70	104	2.4e-136	444.5
TkA05G465980	`PF08967`	ENCP4	80	93	0.47	11.4
TkA05G465980	`PF13812`	PPR_3	82	101	1.9e-64	214.3
TkA05G465980	`PF12854`	PPR_1	87	103	4.5e-109	356.5
TkA05G465980	`PF01535`	PPR	93	120	3.6e-96	309.6
TkA05G465980	`PF10602`	RPN7	129	183	0.043	14.2
TkA05G465980	`PF08967`	ENCP4	130	148	0.47	11.4
TkA05G465980	`PF24760`	TPR_IF140_C	132	175	9.8e-08	33.2
TkA05G465980	`PF23276`	TPR_24	137	174	7.3e-46	156.1
TkA05G465980	`PF29070`	MSC6_N	142	239	1.2e-33	117.5
TkA05G465980	`PF28559`	TPR_SusR	144	186	0.00054	20.3
TkA05G465980	`PF23276`	TPR_24	154	194	7.3e-46	156.1
TkA05G465980	`PF10037`	MRP-S27	154	247	2.2e-10	40.8
TkA05G465980	`PF13176`	TPR_7	154	174	4.3e-05	24.0
TkA05G465980	`PF13428`	TPR_14	154	176	0.00081	20.6
TkA05G465980	`PF13041`	PPR_2	156	196	2.4e-136	444.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O81028`	Arabidopsis thaliana	sp\|O81028\|PP171_ARATH Pentatricopeptide repeat-containing protein At2g26790, mitochondrial	39.200%	Swiss-Prot	Low
`Q9LMH5`	Arabidopsis thaliana	sp\|Q9LMH5\|PPR42_ARATH Putative pentatricopeptide repeat-containing protein At1g13800	28.700%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card