TkA05G456930 | RubberDandelionOmics

Gene overview

TkA05G456930

Reference: TK1151 Chr: Chr05 Coordinates: 114470973-114472310 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

614 bp · TkA05G456930|TK1151|cDNA

TTGAAAAGAAGATGACAGAGCTTTGCTGCTCAATACTATCTGCTATAATTTTCCGATTACTCTTTCTGTTCATCATTTTCCAGTTTGGAATTGTTGGAGCTACTCTTGGAGCAATTGCAGGGGCAATGATAGGATGGAGTAACAAGAAGAGGTTTGTGGGAGGTGTGATTTTAGGGGCAGTCTATGGGACAACTTTGTCATATAAGCTCATAAACGATACATTTGATTATTTCTTTTCTGATGATGCCGATGCACGGGTC...

CDS

Download CDS FASTA

384 bp · TkA05G456930|TK1151|CDS

ATGACAGAGCTTTGCTGCTCAATACTATCTGCTATAATTTTCCGATTACTCTTTCTGTTCATCATTTTCCAGTTTGGAATTGTTGGAGCTACTCTTGGAGCAATTGCAGGGGCAATGATAGGATGGAGTAACAAGAAGAGGTTTGTGGGAGGTGTGATTTTAGGGGCAGTCTATGGGACAACTTTGTCATATAAGCTCATAAACGATACATTTGATTATTTCTTTTCTGATGATGCCGATGCACGGGTCTTCCTTGTTAA...

Protein

Download Protein FASTA

127 aa · TkA05G456930|TK1151|PROTEIN

MTELCCSILSAIIFRLLFLFIIFQFGIVGATLGAIAGAMIGWSNKKRFVGGVILGAVYGTTLSYKLINDTFDYFFSDDADARVFLVNIVKRITGALEKILGHEEHIFMGFNKASFGKGYSLADLVHS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G456930`
TK1151 ID	TkA05G456930
OH-1004 ID	LXL04_022296
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	40.200
Protein coverage (%)	TK1151 98.425 / OH-1004 62.562 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA05G456930`
Location	Chr05:114470973-114472310 (-)
Description	Similar to NIP2: NEP1-interacting protein 2
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_022296` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006952 defense response Biological Process GO:0009416 response to light stimulus Biological Process GO:0009788 negative regulation of abscisic acid-activated signaling pathway Biological Process GO:0016567 protein ubiquitination Biological Process GO:0034137 positive regulation of toll-like receptor 2 signaling pathway Biological Process GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process Biological Process GO:0045087 innate immune response Biological Process GO:0046330 positive regulation of JNK cascade Biological Process GO:0141163 positive regulation of cAMP/PKA signal transduction Biological Process GO:1900745 positive regulation of p38MAPK cascade Biological Process GO:0000139 Golgi membrane Cellular Component GO:0005634 nucleus Cellular Component
KEGG gene cross-reference	ath:AT2G17730 ath:AT4G35840 ath:AT5G66070 mmu:224938 rno:192256 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.329

Rank 1 · TkA05G456930 · TK1151

Extracellular0.179

Rank 2 · TkA05G456930 · TK1151

Mitochondrion0.112

Rank 3 · TkA05G456930 · TK1151

Lysosome / Vacuole0.095

Rank 4 · TkA05G456930 · TK1151

Cytoplasm0.083

Rank 5 · TkA05G456930 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF27822SIGLECL1_C10-23 aa

PF29034SDH624-83 aa

PF05818TraT25-70 aa

PF05433Rick_17kDa_Anti26-60 aa

PF27527Y2009_N27-38 aa

PF13441Gly-zipper_YMGG28-61 aa

PF27822SIGLECL1_C28-40 aa

PF13488Gly-zipper_Omp28-61 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G456930	`PF27822`	SIGLECL1_C	10	23	0.095	13.3
TkA05G456930	`PF29034`	SDH6	24	83	0.01	16.6
TkA05G456930	`PF05818`	TraT	25	70	0.35	11.3
TkA05G456930	`PF05433`	Rick_17kDa_Anti	26	60	0.024	15.2
TkA05G456930	`PF27527`	Y2009_N	27	38	0.076	13.5
TkA05G456930	`PF13441`	Gly-zipper_YMGG	28	61	0.0013	19.4
TkA05G456930	`PF27822`	SIGLECL1_C	28	40	0.095	13.3
TkA05G456930	`PF13488`	Gly-zipper_Omp	28	61	0.71	10.5
TkA05G456930	`PF13436`	Gly-zipper_OmpA	28	41	1.3	9.6
TkA05G456930	`PF27527`	Y2009_N	43	59	0.076	13.5
TkA05G456930	`PF27822`	SIGLECL1_C	45	61	0.095	13.3
TkA05G456930	`PF13436`	Gly-zipper_OmpA	50	59	1.3	9.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card