LXL04_022296 | RubberDandelionOmics

Gene overview

LXL04_022296

Reference: OH-1004 Chr: Chr04 Coordinates: 147765784-147767165 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

612 bp · LXL04_022296|LXL04_022296|OH1004|cDNA

ATGGTTTCTTCGTTTCTAAGAACTCCGTTTCATTATGGTGAGAAGATGAGAGAGGTTTGCACCACCATGTTTTCGCTGGTTTTCTTCCAAGTCCTCCTTCTCATATTCGGCTTCCAATTTGGTGTATTTGGGGGTACAATCGGAGCTTTAGGAGGAGCATTGATCGGATTTAAGAACAAAAAGAACTTCTTCCAAGATGTGATCGTGGGGGCAGCATCTGGGGCAGTTTTATCACAGAAAATTACTACGGCTACCTTTGA...

CDS

Download CDS FASTA

612 bp · LXL04_022296|LXL04_022296|OH1004|CDS

ATGGTTTCTTCGTTTCTAAGAACTCCGTTTCATTATGGTGAGAAGATGAGAGAGGTTTGCACCACCATGTTTTCGCTGGTTTTCTTCCAAGTCCTCCTTCTCATATTCGGCTTCCAATTTGGTGTATTTGGGGGTACAATCGGAGCTTTAGGAGGAGCATTGATCGGATTTAAGAACAAAAAGAACTTCTTCCAAGATGTGATCGTGGGGGCAGCATCTGGGGCAGTTTTATCACAGAAAATTACTACGGCTACCTTTGA...

Protein

Download Protein FASTA

203 aa · LXL04_022296|LXL04_022296|OH1004|PROTEIN

MVSSFLRTPFHYGEKMREVCTTMFSLVFFQVLLLIFGFQFGVFGGTIGALGGALIGFKNKKNFFQDVIVGAASGAVLSQKITTATFEQFLYSDHDDEHGCFLHLVDIVASALEPKLLRDENHIFLITKVASCEKLIKLPKIAIIKDHVFDASGNATCCSICLQDFEVEDAAAMFPKCEHKFHPECISQWLLAHNSCPVCRRSI

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_022296`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_022296

Location Chr04:147765784-147767165 (+)

Description Similar to NIP2: NEP1-interacting protein 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g17730`	Intrinsic thylakoid membrane protein that fixes RPOT2 on the stromal side of the thylakoid membrane.	No verified direct reference in this release
`At4g35840`	Intrinsic thylakoid membrane protein that fixes RPOT2 on the stromal side of the thylakoid membrane.	No verified direct reference in this release
`At5g66070`	May be involved in the early steps of the plant defense signaling pathway.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_022296 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0009416 response to light stimulus Biological Process

GO:0009788 negative regulation of abscisic acid-activated signaling pathway Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0034137 positive regulation of toll-like receptor 2 signaling pathway Biological Process

GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process Biological Process

GO:0045087 innate immune response Biological Process

GO:0046330 positive regulation of JNK cascade Biological Process

GO:0141163 positive regulation of cAMP/PKA signal transduction Biological Process

GO:1900745 positive regulation of p38MAPK cascade Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT2G17730

ath:AT4G35840

ath:AT5G66070

mmu:224938

rno:192256

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.338

Rank 1 · LXL04_022296 · OH-1004

Cytoplasm0.258

Rank 2 · LXL04_022296 · OH-1004

Nucleus0.203

Rank 3 · LXL04_022296 · OH-1004

Golgi apparatus0.140

Rank 4 · LXL04_022296 · OH-1004

Cell membrane0.133

Rank 5 · LXL04_022296 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13639.13zf-RING_2157-200 aa

PF12678.14zf-rbx1157-200 aa

PF17123.12zf-RING_11158-186 aa

PF13923.13zf-C3HC4_2158-199 aa

PF00097.32zf-C3HC4158-199 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_022296	`PF13639.13`	zf-RING_2	157	200	1.2e-12	48.6
LXL04_022296	`PF12678.14`	zf-rbx1	157	200	1.7e-07	32.1
LXL04_022296	`PF17123.12`	zf-RING_11	158	186	3.7e-08	33.6
LXL04_022296	`PF13923.13`	zf-C3HC4_2	158	199	2.3e-07	31.2
LXL04_022296	`PF00097.32`	zf-C3HC4	158	199	1.8e-06	28.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8GT74`	Arabidopsis thaliana	NEP1-interacting protein 2	32.569%	Swiss-Prot	moderate database homology
`Q8GT75`	Arabidopsis thaliana	NEP1-interacting protein 1	31.651%	Swiss-Prot	moderate database homology
`Q9FKX5`	Arabidopsis thaliana	NEP1-interacting protein-like 1	34.896%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card