TkA05G452410 | RubberDandelionOmics

Gene overview

TkA05G452410

Reference: TK1151 Chr: Chr05 Coordinates: 113263574-113268824 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3112 bp · TkA05G452410|TK1151|cDNA

AAAAAATTGAAGAAAAAGCCCATTATTTATTCATCTTACATCAGCCATCTTGAGTTCTGTACTTGTATTCTCCCTGACGAATCATCACACTTCCATCTTAAAGATTGAATCTTTCCTTCACTACCAAGGATCTTGATTCTTGATCAACTGTTGCGATTCCCTAGGGGGCTTATGGTGGGGTTCCTGAGATTGCAAGGAGAATCTTGAACAAACAACAAATCAGCACGATTGGAAAAAGGTTTCAAGAACATAGGATTTAA...

CDS

Download CDS FASTA

1869 bp · TkA05G452410|TK1151|CDS

ATGGATAATAATAATGATGCGTTTACATTCGAAAATCCATCAGACTCACTTATGGATTTCGATTACATGGATGAACTCTTGTTAGACGGGTGTTGGTTACAAGCAACCGACGGATCCGAAATCGTGAACAACAATCCTCCTCCTTCCAACTCCATCTTCAATCCTTCATTTCAATGGCCGAATTTGGAATCCAATATCGGGGAGCCAGTTTCAAAAGACATGATCACCCCCGAAAGAAATTCGTCGAATCCCCATATCAA...

Protein

Download Protein FASTA

622 aa · TkA05G452410|TK1151|PROTEIN

MDNNNDAFTFENPSDSLMDFDYMDELLLDGCWLQATDGSEIVNNNPPPSNSIFNPSFQWPNLESNIGEPVSKDMITPERNSSNPHIKNLINQPESSKRWWIPPRASSGPSLSVIERLIYAIDNIKHYTVDKNVLIQVWLPEIRDGQKELCTSQQLFSLELNCPRLSNYRSISEKYRFPAEGNPTESVGLPGRVFMGKVPEWTPDVRLFKVEEYPRVSHAQEQDVRGSVAVPVFDQDVKNCIGVVEVIMTTQKSTYPLEIQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G452410`
TK1151 ID	TkA05G452410
OH-1004 ID	LXL04_015217
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	61.500
Protein coverage (%)	TK1151 93.087 / OH-1004 71.795 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G452410

Location Chr05:113263574-113268824 (+)

Description Similar to NLP4: Protein NLP4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g76350`	Probable transcription factor.	No verified direct reference in this release
`At1g20640`	Probable transcription factor.	No verified direct reference in this release
`At4g35270`	Probable transcription factor.	No verified direct reference in this release
`At2g17150`	Probable transcription factor.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0131100`	Probable transcription factor.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_015217 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0010167 response to nitrate Biological Process

GO:0005634 nucleus Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0000987 cis-regulatory region sequence-specific DNA binding Molecular Function

GO:0001216 DNA-binding transcription activator activity Molecular Function

GO:0003677 DNA binding Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

KEGG gene cross-reference

ath:AT1G20640

ath:AT1G64530

ath:AT1G76350

ath:AT4G38340

dosa:Os01g0236700

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.762

Rank 1 · TkA05G452410 · TK1151

Cytoplasm0.295

Rank 2 · TkA05G452410 · TK1151

Cell membrane0.084

Rank 3 · TkA05G452410 · TK1151

Endoplasmic reticulum0.048

Rank 4 · TkA05G452410 · TK1151

Plastid0.023

Rank 5 · TkA05G452410 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13185GAF_235-71 aa

PF22922GAF_NLP135-251 aa

PF13185GAF_2186-257 aa

PF14215bHLH-MYC_N187-234 aa

PF22922GAF_NLP286-456 aa

PF14215bHLH-MYC_N351-407 aa

PF13185GAF_2353-396 aa

PF14215bHLH-MYC_N431-468 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G452410	`PF13185`	GAF_2	35	71	6.3e-07	30.4
TkA05G452410	`PF22922`	GAF_NLP	135	251	5.6e-80	267.6
TkA05G452410	`PF13185`	GAF_2	186	257	6.3e-07	30.4
TkA05G452410	`PF14215`	bHLH-MYC_N	187	234	0.17	12.9
TkA05G452410	`PF22922`	GAF_NLP	286	456	5.6e-80	267.6
TkA05G452410	`PF14215`	bHLH-MYC_N	351	407	0.17	12.9
TkA05G452410	`PF13185`	GAF_2	353	396	6.3e-07	30.4
TkA05G452410	`PF14215`	bHLH-MYC_N	431	468	0.17	12.9
TkA05G452410	`PF01498`	HTH_Tnp_Tc3_2	449	477	0.18	12.8
TkA05G452410	`PF02042`	RWP-RK	515	601	1.1e-26	93.4
TkA05G452410	`PF13542`	HTH_Tnp_ISL3	525	554	0.094	12.9
TkA05G452410	`PF12728`	HTH_17	532	563	0.23	12.5
TkA05G452410	`PF01498`	HTH_Tnp_Tc3_2	537	566	0.18	12.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SFW8`	Arabidopsis thaliana	sp\|Q9SFW8\|NLP5_ARATH Protein NLP5	48.900%	Swiss-Prot	Medium
`Q9LE38`	Arabidopsis thaliana	sp\|Q9LE38\|NLP4_ARATH Protein NLP4	48.000%	Swiss-Prot	Medium
`Q7X9B9`	Arabidopsis thaliana	sp\|Q7X9B9\|NLP2_ARATH Protein NLP2	39.800%	Swiss-Prot	Medium
`Q8H111`	Arabidopsis thaliana	sp\|Q8H111\|NLP1_ARATH Protein NLP1	41.600%	Swiss-Prot	Medium
`Q10S83`	Oryza sativa subsp. japonica	sp\|Q10S83\|NLP1_ORYSJ Protein NLP1	44.700%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card