LXL04_015217 | RubberDandelionOmics

Gene overview

LXL04_015217

Reference: OH-1004 Chr: Chr03 Coordinates: 66140753-66143932 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2460 bp · LXL04_015217|LXL04_015217|OH1004|cDNA

ATGGACGATAGCGTATTTCCTCCCAATAACATGTTCGAGAATCCCTCCGAATCCTTAATGGACTACGATTACATGGACGAACTTTTACTAGACGGGTGTTGGCTACAAGCAACAGACGGATCCGAATTCATaaacaacaacagcaacaatAATCCCCTTTTCGATACTCCATTTCTATGGCCCACTTTTGACGACATTCAAGAAAATCAAGAAGGTGGGAATTCATCAAAAACCCTCGTGTGTAATTCCGTCGGATTTCA...

CDS

Download CDS FASTA

2460 bp · LXL04_015217|LXL04_015217|OH1004|CDS

ATGGACGATAGCGTATTTCCTCCCAATAACATGTTCGAGAATCCCTCCGAATCCTTAATGGACTACGATTACATGGACGAACTTTTACTAGACGGGTGTTGGCTACAAGCAACAGACGGATCCGAATTCATAAACAACAACAGCAACAATAATCCCCTTTTCGATACTCCATTTCTATGGCCCACTTTTGACGACATTCAAGAAAATCAAGAAGGTGGGAATTCATCAAAAACCCTCGTGTGTAATTCCGTCGGATTTCA...

Protein

Download Protein FASTA

819 aa · LXL04_015217|LXL04_015217|OH1004|PROTEIN

MDDSVFPPNNMFENPSESLMDYDYMDELLLDGCWLQATDGSEFINNNSNNNPLFDTPFLWPTFDDIQENQEGGNSSKTLVCNSVGFHNQSENFQFENPDMSRRWWIPPGIGPSLSVKERLFYAIESIKQSTFQRNMLIQIWLPENQEGKKVLRTSSQLSSLDTNCPQLSYYRNISEGYEFPAEGNSKEIVGLPGRVFMGKVPEWTPDVRFFKTEEYPRVGHAQEFDVKGTVAIPVFDRDSQSCLGVIEVVMTTQKSSYNP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_015217`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_015217

Location Chr03:66140753-66143932 (+)

Description Similar to NLP4: Protein NLP4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g20640`	Probable transcription factor.	No verified direct reference in this release
`At1g76350`	Probable transcription factor.	No verified direct reference in this release
`At1g64530`	Probable transcription factor.	No verified direct reference in this release
`At4g38340`	Probable transcription factor.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0236700`	Probable transcription factor.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_015217 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0010167 response to nitrate Biological Process

GO:0005634 nucleus Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0000987 cis-regulatory region sequence-specific DNA binding Molecular Function

GO:0001216 DNA-binding transcription activator activity Molecular Function

GO:0003677 DNA binding Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

KEGG gene cross-reference

ath:AT1G20640

ath:AT1G64530

ath:AT1G76350

ath:AT4G38340

dosa:Os01g0236700

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.940

Rank 1 · LXL04_015217 · OH-1004

Cytoplasm0.118

Rank 2 · LXL04_015217 · OH-1004

Cell membrane0.044

Rank 3 · LXL04_015217 · OH-1004

Endoplasmic reticulum0.028

Rank 4 · LXL04_015217 · OH-1004

Plastid0.018

Rank 5 · LXL04_015217 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF22922.3GAF_NLP137-254 aa

PF22922.3GAF_NLP290-460 aa

PF02042.22RWP-RK525-597 aa

PF00564.31PB1725-805 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_015217	`PF22922.3`	GAF_NLP	137	254	7.7e-90	299.8
LXL04_015217	`PF22922.3`	GAF_NLP	290	460	7.7e-90	299.8
LXL04_015217	`PF02042.22`	RWP-RK	525	597	3.9e-26	91.7
LXL04_015217	`PF00564.31`	PB1	725	805	6.4e-19	68.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LE38`	Arabidopsis thaliana	Protein NLP4	47.674%	Swiss-Prot	moderate database homology
`Q9SFW8`	Arabidopsis thaliana	Protein NLP5	48.171%	Swiss-Prot	moderate database homology
`Q8RWY4`	Arabidopsis thaliana	Protein NLP6	36.990%	Swiss-Prot	moderate database homology
`Q9SVF1`	Arabidopsis thaliana	Protein NLP3	39.390%	Swiss-Prot	moderate database homology
`Q5NB82`	Oryza sativa subsp. japonica	Protein NLP3	35.802%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card