TkA05G391450 | RubberDandelionOmics

Gene overview

TkA05G391450

Reference: TK1151 Chr: Chr05 Coordinates: 97271372-97274124 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1878 bp · TkA05G391450|TK1151|cDNA

TTAATTTATACAGAATGTTTGAGATATTTCTAAGCAAATAATTGTTCATATTTTACCAATCGTTATACCTATATGTAGTTAAACAAAAAAGCCGCCATATAAATGTTATGCACACTATAATAATGGCCTGAAAGAATTTTACCGCCCAAATTACTCATACATATTTAAACAAAAAAAACTTAAATATGACAAATCGTACCATATAGGCAGGTGTAAGGAGCATTTAAGGCTCATCAAATGCAACGTCATGAATGCGCCTA...

CDS

Download CDS FASTA

1392 bp · TkA05G391450|TK1151|CDS

ATGGAATCTGCGGTGGCTGATTTGGACGGCTGGCGTAATCTGAGGGTGGTGGAAACCATCTACGAGGAGGATTCCGGTGACTCTTCTTCCTCCACTACCCCTTCTCTCTCCTCTCCTCCGCCTCCCTCCTCCCCTTCCACAACCTCTCTCCGCTCCCGAGTTAAAGCTTGGTCCTTCAATAATGGAGTTGAAACCAATGTGATGGTACATGTTCAAGAGTCAACTTTTCACTTGCACAAGGATCCTCTGGCGCGATGCAG...

Protein

Download Protein FASTA

463 aa · TkA05G391450|TK1151|PROTEIN

MESAVADLDGWRNLRVVETIYEEDSGDSSSSTTPSLSSPPPPSSPSTTSLRSRVKAWSFNNGVETNVMVHVQESTFHLHKDPLARCSRYLKRQLTESSEVSLSPPLKITPHTFTLVADYCYGGNLFITPFNLASLLLAAELLEMHDGPENVENLRRKTEAYYQRTVAVDRDYATVVLKSCMELLPDVETKTGLLTRCVEALSLNRDGGHVLSMFDGVQKLSGEEFRLVVGALHQKVAGSHDLLYRIIDFYFKEVGGKMTE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G391450`
TK1151 ID	TkA05G391450
OH-1004 ID	LXL04_006700
Relationship / confidence	Rbh High Identity Coverage Local Synteny Minor Chr Pair / Probable
Protein identity (%)	99.800
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G391450

Location Chr05:97271372-97274124 (+)

Description Similar to At3g49900: BTB/POZ domain-containing protein At3g49900

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g49900`	May act as a substrate-specific adapter of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.	No verified direct reference in this release
`At3g50840`	May act as a substrate-specific adapter of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.	No verified direct reference in this release
`At5g13600`	May act as a substrate-specific adapter of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.	No verified direct reference in this release
`At5g48130`	May act as a substrate-specific adapter of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.	No verified direct reference in this release
`At3g03510`	May act as a substrate-specific adapter of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_006700 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0007165 signal transduction Biological Process

GO:0009638 phototropism Biological Process

GO:0009904 chloroplast accumulation movement Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005777 peroxisome Cellular Component

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT2G30520

ath:AT3G49900

ath:AT5G67385

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.502

Rank 1 · TkA05G391450 · TK1151

Nucleus0.387

Rank 2 · TkA05G391450 · TK1151

Cell membrane0.234

Rank 3 · TkA05G391450 · TK1151

Endoplasmic reticulum0.045

Rank 4 · TkA05G391450 · TK1151

Lysosome / Vacuole0.035

Rank 5 · TkA05G391450 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00651BTB59-153 aa

PF26725TPR_INTS8_369-103 aa

PF11822BTB_SANBR72-146 aa

PF19111DUF5798149-173 aa

PF03000NPH3219-278 aa

PF26725TPR_INTS8_3260-379 aa

PF16689APC_N_CC341-378 aa

PF19111DUF5798346-378 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G391450	`PF00651`	BTB	59	153	3.6e-11	43.9
TkA05G391450	`PF26725`	TPR_INTS8_3	69	103	0.25	11.7
TkA05G391450	`PF11822`	BTB_SANBR	72	146	0.018	16.0
TkA05G391450	`PF19111`	DUF5798	149	173	0.0027	18.6
TkA05G391450	`PF03000`	NPH3	219	278	7.4e-08	33.1
TkA05G391450	`PF26725`	TPR_INTS8_3	260	379	0.25	11.7
TkA05G391450	`PF16689`	APC_N_CC	341	378	0.21	12.5
TkA05G391450	`PF19111`	DUF5798	346	378	0.0027	18.6
TkA05G391450	`PF11822`	BTB_SANBR	351	376	0.018	16.0
TkA05G391450	`PF14077`	WDR18_C	356	376	0.12	13.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M2W8`	Arabidopsis thaliana	sp\|Q9M2W8\|Y3990_ARATH BTB/POZ domain-containing protein At3g49900	41.500%	Swiss-Prot	Medium
`Q8LPQ3`	Arabidopsis thaliana	sp\|Q8LPQ3\|Y3084_ARATH BTB/POZ domain-containing protein At3g50840	32.500%	Swiss-Prot	Low
`Q9FNB3`	Arabidopsis thaliana	sp\|Q9FNB3\|Y5360_ARATH Putative BTB/POZ domain-containing protein At5g13600	33.100%	Swiss-Prot	Low
`Q9LUB9`	Arabidopsis thaliana	sp\|Q9LUB9\|Y5813_ARATH BTB/POZ domain-containing protein At5g48130	30.400%	Swiss-Prot	Low
`Q9SRQ5`	Arabidopsis thaliana	sp\|Q9SRQ5\|Y3351_ARATH BTB/POZ domain-containing protein At3g03510	35.400%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card