TkA05G012420 | RubberDandelionOmics

Gene overview

TkA05G012420

Reference: TK1151 Chr: Chr05 Coordinates: 3545432-3550816 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2956 bp · TkA05G012420|TK1151|cDNA

TTTACGTCAGTTAACAAAACCCTATCGCAAACTTCATAGCCGTTCCTTCCTCTCGTCTTCGACCAGAAACCAAACAAATCGGGGGTTCTCTCTGTCTCGCTCGAATTCACAGCTGCTACTCGCTCGTAAAAGCAGATATCTTCTTAGCTGATAATTGGAAATAACCAGCAAAAAGATGACTTCAGTGACATTGAAGAAGAACTACCGTTGTGTTCAGTCACTGCAACAATTCTACTCAGGCGGACCCTACACAGTCTCTT...

CDS

Download CDS FASTA

2535 bp · TkA05G012420|TK1151|CDS

ATGACTTCAGTGACATTGAAGAAGAACTACCGTTGTGTTCAGTCACTGCAACAATTCTACTCAGGCGGACCCTACACAGTCTCTTCTGTTGGATCATTCATAGCCTGTGCATGCAATGACACCATCACCATAGTCGATTCCTCCAATGCTTCCATTAAATCCACCATTGAAGGTGATTCAGAGTCTGTCACAGCTCTTACTCTTAGCCCTGATGACAAGTTCCTCTTTTCCGCCAGTCACAGTCGCCAAATTAGGGTCTG...

Protein

Download Protein FASTA

844 aa · TkA05G012420|TK1151|PROTEIN

MTSVTLKKNYRCVQSLQQFYSGGPYTVSSVGSFIACACNDTITIVDSSNASIKSTIEGDSESVTALTLSPDDKFLFSASHSRQIRVWDLSSLKCLRSWKGHEGPVMGMTCHASGGLLATAGADGKVKVWDVDGGFCTHFFKGHKGVVTSAVFHPDPNNLLLFSSSDDTTVRIWDLTSKKCVANLERHRSTVTSIAITEDGWTLISGGRDQVVNLWDLHDYSCKMSVPTNEAIEGVCYVGSLSPFASCVQGKKVGDSSAFQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G012420`
TK1151 ID	TkA05G012420
OH-1004 ID	LXL04_019027
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	97.400
Protein coverage (%)	TK1151 99.289 / OH-1004 93.841 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G012420

Location Chr05:3545432-3550816 (+)

Description Similar to Tbl3: Transducin beta-like protein 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g16750`	Essential protein involved in the regulation of cell division planes during embryogenesis which defines cell patterning, especially longitudinal division planes of the proembryo, probably via the regulation of embryo patterning genes expression patterns.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_019027 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000472 endonucleolytic cleavage to generate mature 5'-end of SSU-rRNA from (SSU-rRNA, 5.8S rRNA, LSU-rRNA) Biological Process

GO:0000480 endonucleolytic cleavage in 5'-ETS of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0009880 embryonic pattern specification Biological Process

GO:0030490 maturation of SSU-rRNA Biological Process

GO:0042274 ribosomal small subunit biogenesis Biological Process

GO:0051301 cell division Biological Process

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0030686 90S preribosome Cellular Component

GO:0032040 small-subunit processome Cellular Component

KEGG gene cross-reference

ath:AT5G16750

bta:618429

hsa:10607

mmu:213773

rno:287120

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.847

Rank 1 · TkA05G012420 · TK1151

Cytoplasm0.198

Rank 2 · TkA05G012420 · TK1151

Mitochondrion0.025

Rank 3 · TkA05G012420 · TK1151

Cell membrane0.023

Rank 4 · TkA05G012420 · TK1151

Golgi apparatus0.021

Rank 5 · TkA05G012420 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF15492Nbas_N12-104 aa

PF23410Beta-prop_VPS817-101 aa

PF20426NBCH_WD4021-131 aa

PF25174Beta-prop_THOC325-155 aa

PF00400WD4025-44 aa

PF23414Beta-prop_EML_225-133 aa

PF29037DSE1_N26-133 aa

PF23342WDR90_beta-prop_4th26-90 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G012420	`PF15492`	Nbas_N	12	104	0.0013	18.9
TkA05G012420	`PF23410`	Beta-prop_VPS8	17	101	9.3e-09	35.5
TkA05G012420	`PF20426`	NBCH_WD40	21	131	1.5e-17	64.3
TkA05G012420	`PF25174`	Beta-prop_THOC3	25	155	4.7e-81	272.5
TkA05G012420	`PF00400`	WD40	25	44	8.6e-80	260.5
TkA05G012420	`PF23414`	Beta-prop_EML_2	25	133	1.3e-44	153.3
TkA05G012420	`PF29037`	DSE1_N	26	133	1.1e-23	84.7
TkA05G012420	`PF23342`	WDR90_beta-prop_4th	26	90	5.3e-16	59.3
TkA05G012420	`PF13570`	Beta-prop_ACSF4	27	321	2.6e-06	27.8
TkA05G012420	`PF23769`	Beta-prop_WDR75_2nd	27	99	9.9e-05	22.0
TkA05G012420	`PF25175`	Beta-prop_WDR5	28	156	6.5e-98	328.3
TkA05G012420	`PF24807`	WD40_CDC20-Fz	29	184	1.2e-66	225.8
TkA05G012420	`PF24782`	WD40_MABP1-WDR62_2nd	29	89	1.1e-39	137.1
TkA05G012420	`PF23409`	Beta-prop_EML	29	89	9.4e-33	114.5
TkA05G012420	`PF23381`	Beta-prop_IFT122_1st	30	95	3e-78	263.7
TkA05G012420	`PF24817`	WD40_WDHD1_1st	30	100	1.1e-57	196.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LFE2`	Arabidopsis thaliana	sp\|Q9LFE2\|TOZ_ARATH Protein TORMOZ EMBRYO DEFECTIVE	67.600%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card