LXL04_019027 | RubberDandelionOmics

Gene overview

LXL04_019027

Reference: OH-1004 Chr: Chr04 Coordinates: 22333094-22337180 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2682 bp · LXL04_019027|LXL04_019027|OH1004|cDNA

ATGGCTTCAGTGACATTGAAGAAGAACTACCGTTGTGTTCAGTCACTGCAACAATTCTACTCAGGCGGACCCTACACAGTCTCTTCTGATGGATCATTCATAGCCTGTGCATGCAATGACACCATCACCATAGTCGATTCCTCCAATGCTTCCATTAAGTCCACCATTGAAGGTGATTCAGAGTCTGTCACAGCTCTTACTCTTAGCCCTGATGACAAGTTCCTCTTTTCCGCCGGTCACAGTCGCCAAATTAGGGTCTG...

CDS

Download CDS FASTA

2682 bp · LXL04_019027|LXL04_019027|OH1004|CDS

ATGGCTTCAGTGACATTGAAGAAGAACTACCGTTGTGTTCAGTCACTGCAACAATTCTACTCAGGCGGACCCTACACAGTCTCTTCTGATGGATCATTCATAGCCTGTGCATGCAATGACACCATCACCATAGTCGATTCCTCCAATGCTTCCATTAAGTCCACCATTGAAGGTGATTCAGAGTCTGTCACAGCTCTTACTCTTAGCCCTGATGACAAGTTCCTCTTTTCCGCCGGTCACAGTCGCCAAATTAGGGTCTG...

Protein

Download Protein FASTA

893 aa · LXL04_019027|LXL04_019027|OH1004|PROTEIN

MASVTLKKNYRCVQSLQQFYSGGPYTVSSDGSFIACACNDTITIVDSSNASIKSTIEGDSESVTALTLSPDDKFLFSAGHSRQIRVWDLSSLKCLRSWKGHEGPVMGMTCHASGGLLATAGADGKVKVWDVDGGFCTHFFKGHKGVVTSVVFHPDPNNLLLFSSSDDTTVRIWDLTSKKCVANLERHRSTVTSIAITEDGWTLISGGRDQVVNLWDLHDYSCKMSVPTNEAIEGVCYVGSLSPFASCVQGKKVGDSSAFQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_019027`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_019027

Location Chr04:22333094-22337180 (+)

Description Similar to Tbl3: Transducin beta-like protein 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g16750`	Essential protein involved in the regulation of cell division planes during embryogenesis which defines cell patterning, especially longitudinal division planes of the proembryo, probably via the regulation of embryo patterning genes expression patterns.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_019027 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000472 endonucleolytic cleavage to generate mature 5'-end of SSU-rRNA from (SSU-rRNA, 5.8S rRNA, LSU-rRNA) Biological Process

GO:0000480 endonucleolytic cleavage in 5'-ETS of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0009880 embryonic pattern specification Biological Process

GO:0030490 maturation of SSU-rRNA Biological Process

GO:0042274 ribosomal small subunit biogenesis Biological Process

GO:0051301 cell division Biological Process

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0030686 90S preribosome Cellular Component

GO:0032040 small-subunit processome Cellular Component

KEGG gene cross-reference

ath:AT5G16750

bta:618429

hsa:10607

mmu:213773

rno:287120

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.769

Rank 1 · LXL04_019027 · OH-1004

Cytoplasm0.235

Rank 2 · LXL04_019027 · OH-1004

Golgi apparatus0.031

Rank 3 · LXL04_019027 · OH-1004

Cell membrane0.031

Rank 4 · LXL04_019027 · OH-1004

Mitochondrion0.028

Rank 5 · LXL04_019027 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF25172.2Beta-prop_WDR3_2nd7-91 aa

PF25174.2Beta-prop_THOC312-155 aa

PF23410.5Beta-prop_VPS821-101 aa

PF23414.2Beta-prop_EML_225-132 aa

PF24817.2WD40_WDHD1_1st26-100 aa

PF25175.2Beta-prop_WDR527-157 aa

PF23381.2Beta-prop_IFT122_1st28-95 aa

PF24807.2WD40_CDC20-Fz28-183 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_019027	`PF25172.2`	Beta-prop_WDR3_2nd	7	91	1.5e-74	251.6
LXL04_019027	`PF25174.2`	Beta-prop_THOC3	12	155	9.7e-90	301.0
LXL04_019027	`PF23410.5`	Beta-prop_VPS8	21	101	2.4e-08	34.1
LXL04_019027	`PF23414.2`	Beta-prop_EML_2	25	132	7.4e-45	154.1
LXL04_019027	`PF24817.2`	WD40_WDHD1_1st	26	100	7.2e-59	200.1
LXL04_019027	`PF25175.2`	Beta-prop_WDR5	27	157	1.2e-98	330.8
LXL04_019027	`PF23381.2`	Beta-prop_IFT122_1st	28	95	2.5e-79	267.2
LXL04_019027	`PF24807.2`	WD40_CDC20-Fz	28	183	1.4e-59	202.6
LXL04_019027	`PF25168.2`	Beta-prop_WDR36-Utp21_2nd	28	93	8.6e-40	137.7
LXL04_019027	`PF25391.2`	WD40_Gbeta	29	175	2.9e-43	148.9
LXL04_019027	`PF24782.3`	WD40_MABP1-WDR62_2nd	29	89	2.1e-42	146.0
LXL04_019027	`PF24814.2`	WD40_Prp19	32	235	2.4e-92	309.7
LXL04_019027	`PF25173.2`	Beta-prop_WDR3_1st	33	217	1.7e-94	315.4
LXL04_019027	`PF25171.2`	Beta-prop_WDR36-Utp21_1st	37	132	1.2e-31	110.9
LXL04_019027	`PF25047.1`	Beta-prop_TEP1_2nd	47	274	1.7e-38	132.9
LXL04_019027	`PF24796.2`	WDR55	51	221	1.7e-38	133.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LFE2`	Arabidopsis thaliana	Protein TORMOZ EMBRYO DEFECTIVE	67.678%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card