TkA04G464000 | RubberDandelionOmics

Gene overview

TkA04G464000

Reference: TK1151 Chr: Chr04 Coordinates: 117137841-117140902 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2105 bp · TkA04G464000|TK1151|cDNA

AAGAACTTGAAATAAACCCATTGAAACTATACAAACATCTTATTCTCCAGATGGCTATCCTCATACTAATTTTAGTGGCCACATTCAACATTTTATCCACCAATAGCCAACATCACCCTTTGGATCCTCTCAATCCAAATGAAATATCCCAAATTCAAAAAATCATCAAAAACTCTCACCTTTCTTCAATTCCCAATCTCACATTCCATTTCGTTGATCTAAACGAACCCGACAAAAACCACGTCCTCCAATGGCTGTCA...

CDS

Download CDS FASTA

1947 bp · TkA04G464000|TK1151|CDS

ATGGCTATCCTCATACTAATTTTAGTGGCCACATTCAACATTTTATCCACCAATAGCCAACATCACCCTTTGGATCCTCTCAATCCAAATGAAATATCCCAAATTCAAAAAATCATCAAAAACTCTCACCTTTCTTCAATTCCCAATCTCACATTCCATTTCGTTGATCTAAACGAACCCGACAAAAACCACGTCCTCCAATGGCTGTCATCATCATCTCCCCACAAACAAAACCAATCTTTCCCTTACCGCCAAGCCAA...

Protein

Download Protein FASTA

648 aa · TkA04G464000|TK1151|PROTEIN

MAILILILVATFNILSTNSQHHPLDPLNPNEISQIQKIIKNSHLSSIPNLTFHFVDLNEPDKNHVLQWLSSSSPHKQNQSFPYRQAKIVTRGGGQTHEIVIDLTTDSITSHNIYTGDGYPPNTLTELLQAARLPFKSSRFKSLVSKRGLNFSEITCFPFTIGWFGESVTKRAVRLSCFYRQNTTNVFSRPIEGLAILVDIDLMKIQKLVDRGRSPIPGSEGTDFQTSGTTPDPIINCKKSKKGFTINRHEINWKNWRFHV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G464000`
TK1151 ID	TkA04G464000
OH-1004 ID	LXL04_029705
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	44.900
Protein coverage (%)	TK1151 96.914 / OH-1004 78.395 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G464000

Location Chr04:117137841-117140902 (-)

Description Similar to At1g62810: Primary amine oxidase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g14940`	Oxidizes preferentially the aliphatic diamine putrescine with production of the corresponding aldehyde, ammonia and hydrogen peroxide.	The Apoplastic Copper AMINE OXIDASE1 Mediates Jasmonic Acid-Induced Protoxylem Differentiation in Arabidopsis Roots.2015 · DOI: 10.1104/pp.15.00121
`At1g31690`	Copper amine oxidase that can use putrescine and spermidine as substrates.	Copper amine oxidase 8 regulates arginine-dependent nitric oxide production in Arabidopsis thaliana.2017 · DOI: 10.1093/jxb/erx105
`At1g31710`	Copper amine oxidase that can use putrescine and spermidine as substrates.	Copper-containing amine oxidases contribute to terminal polyamine oxidation in peroxisomes and apoplast of Arabidopsis thaliana.2013 · DOI: 10.1186/1471-2229-13-109

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_029705 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0002237 response to molecule of bacterial origin Biological Process

GO:0006809 nitric oxide biosynthetic process Biological Process

GO:0009308 amine metabolic process Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009447 putrescine catabolic process Biological Process

GO:0009611 response to wounding Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009733 response to auxin Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009751 response to salicylic acid Biological Process

GO:0009753 response to jasmonic acid Biological Process

KEGG gene cross-reference

ath:AT1G31690

ath:AT1G31710

ath:AT1G62810

ath:AT3G43670

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.339

Rank 1 · TkA04G464000 · TK1151

Lysosome / Vacuole0.198

Rank 2 · TkA04G464000 · TK1151

Endoplasmic reticulum0.117

Rank 3 · TkA04G464000 · TK1151

Cytoplasm0.071

Rank 4 · TkA04G464000 · TK1151

Cell membrane0.048

Rank 5 · TkA04G464000 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02727Cu_amine_oxidN222-113 aa

PF17793AHD28-58 aa

PF01175Urocanase53-126 aa

PF02728Cu_amine_oxidN3126-226 aa

PF01179Cu_amine_oxid246-647 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G464000	`PF02727`	Cu_amine_oxidN2	22	113	1.1e-22	80.8
TkA04G464000	`PF17793`	AHD	28	58	0.23	12.1
TkA04G464000	`PF01175`	Urocanase	53	126	0.29	11.5
TkA04G464000	`PF02728`	Cu_amine_oxidN3	126	226	9.2e-23	81.1
TkA04G464000	`PF01179`	Cu_amine_oxid	246	647	2.1e-132	442.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O23349`	Arabidopsis thaliana	sp\|O23349\|AO1_ARATH Primary amine oxidase 1	58.500%	Swiss-Prot	High
`F4IAX0`	Arabidopsis thaliana	sp\|F4IAX0\|CAOA2_ARATH Amine oxidase [copper-containing] alpha 2, peroxisomal	51.300%	Swiss-Prot	High
`F4IAX1`	Arabidopsis thaliana	sp\|F4IAX1\|CAOA3_ARATH Amine oxidase [copper-containing] alpha 3, peroxisomal	50.500%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card