RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA04G272590
Reference: TK1151 Chr: Chr04 Coordinates: 68884537-68885519 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

864 bp · TkA04G272590|TK1151|cDNA

ATGCTTGTCGGGATCCCTCTTGAATCAGGGAAGATCTTGTCTACATTTGCAACATTTAAAACACTTCAACAACCAATCTACAATCTTCCTGATACGATATCAATGATAGCCCAAACTAAAGTCTCATTAGATCGTATTGCCTCATATCTCTGTCTTGATGACAAAGATTCTAGCATTGTAGAGATAGGTGGCTCTAATATTGCAATCGAGATTACTAATGGTAGTTTCTCATGGGATGTTTTATCTGGTGAATTGGTACT...

CDS

Download CDS FASTA

864 bp · TkA04G272590|TK1151|CDS

ATGCTTGTCGGGATCCCTCTTGAATCAGGGAAGATCTTGTCTACATTTGCAACATTTAAAACACTTCAACAACCAATCTACAATCTTCCTGATACGATATCAATGATAGCCCAAACTAAAGTCTCATTAGATCGTATTGCCTCATATCTCTGTCTTGATGACAAAGATTCTAGCATTGTAGAGATAGGTGGCTCTAATATTGCAATCGAGATTACTAATGGTAGTTTCTCATGGGATGTTTTATCTGGTGAATTGGTACT...

Protein

Download Protein FASTA

287 aa · TkA04G272590|TK1151|PROTEIN

MLVGIPLESGKILSTFATFKTLQQPIYNLPDTISMIAQTKVSLDRIASYLCLDDKDSSIVEIGGSNIAIEITNGSFSWDVLSGELVLKIINIKVAPGMKVAVCGMVGSGKSSLLSCILGEVPKLSGGVKMSGSKAFVAQSPWIQSGSIEENILFGKEMERTMYDKVLEACVLKKDLEILPFGDQTIIGEWGINLSGGQKQRLQIARALYQDADIYLFDDPFSAVDAHTGSHIFKKCLLEFLNLKTVIYVTHQVEFLPDAD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA04G272590
TK1151 IDTkA04G272590
OH-1004 IDLXL04_016188
Relationship / confidenceNon Reciprocal Best Hit / Complex relationship
Protein identity (%)73.400
Protein coverage (%)TK1151 91.986 / OH-1004 18.213
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA04G272590
LocationChr04:68884537-68885519 (-)
DescriptionSimilar to ABCC3: ABC transporter C family member 3
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At3g13080 Pump for glutathione S-conjugates.
An ABC-transporter of Arabidopsis thaliana has both glutathione-conjugate and chlorophyll catabolite transport activity.1998 · DOI: 10.1046/j.1365-313x.1998.00076.x
At3g13090 Pump for glutathione S-conjugates. No verified direct reference in this release
At3g13100 Pump for glutathione S-conjugates. No verified direct reference in this release
At1g04120 Pump for glutathione S-conjugates.
The Arabidopsis thaliana ABC transporter AtMRP5 controls root development and stomata movement.2001 · DOI: 10.1093/emboj/20.8.1875
The plant multidrug resistance ABC transporter AtMRP5 is involved in guard cell hormonal signalling and water use.2003 · DOI: 10.1046/j.1365-313x.2003.016012.x
Binding of sulfonylurea by AtMRP5, an Arabidopsis multidrug resistance-related protein that functions in salt tolerance.2004 · DOI: 10.1104/pp.103.027045
The Arabidopsis ATP-binding cassette protein AtMRP5/AtABCC5 is a high affinity inositol hexakisphosphate transporter involved in guard cell signaling and phytate storage.2009 · DOI: 10.1074/jbc.m109.030247

Rice

Reference gene IDPossible functionPapers / DOI
UniProt: A2XCD4 ABC transporter that may affect phytic acid transport and compartmentalization. No verified direct reference in this release
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_016188 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0051707 response to other organism Biological Process
GO:0055085 transmembrane transport Biological Process
GO:0000325 plant-type vacuole Cellular Component
GO:0005634 nucleus Cellular Component
GO:0005773 vacuole Cellular Component
GO:0005774 vacuolar membrane Cellular Component
GO:0009506 plasmodesma Cellular Component
GO:0009507 chloroplast Cellular Component
GO:0016020 membrane Cellular Component
GO:0048046 apoplast Cellular Component
GO:0005524 ATP binding Molecular Function
GO:0008559 ABC-type xenobiotic transporter activity Molecular Function
KEGG gene cross-reference
ath:AT3G13080
ath:AT3G13090
ath:AT3G13100
dosa:Os03g0142800
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.423
Rank 1 · TkA04G272590 · TK1151
Lysosome / Vacuole0.171
Rank 2 · TkA04G272590 · TK1151
Endoplasmic reticulum0.134
Rank 3 · TkA04G272590 · TK1151
Peroxisome0.131
Rank 4 · TkA04G272590 · TK1151
Nucleus0.127
Rank 5 · TkA04G272590 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00005ABC_tran13-43 aa
PF02463SMC_N16-51 aa
PF00005ABC_tran87-221 aa
PF02463SMC_N94-119 aa
PF20703nSTAND199-129 aa
PF01926MMR_HSR199-123 aa
PF00350Dynamin_N100-120 aa
PF13304AAA_21103-144 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA04G272590PF00005ABC_tran13431.1e-1868.8
TkA04G272590PF02463SMC_N16510.0001522.0
TkA04G272590PF00005ABC_tran872211.1e-1868.8
TkA04G272590PF02463SMC_N941190.0001522.0
TkA04G272590PF20703nSTAND1991290.1112.8
TkA04G272590PF01926MMR_HSR1991230.1812.6
TkA04G272590PF00350Dynamin_N1001200.113.4
TkA04G272590PF13304AAA_211031440.003418.1
TkA04G272590PF02463SMC_N1532610.0001522.0
TkA04G272590PF13304AAA_211942550.003418.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9LK64Arabidopsis thalianasp|Q9LK64|AB3C_ARATH ABC transporter C family member 375.300%Swiss-ProtHigh
Q8VZZ4Arabidopsis thalianasp|Q8VZZ4|AB6C_ARATH ABC transporter C family member 671.900%Swiss-ProtHigh
Q9LK62Arabidopsis thalianasp|Q9LK62|AB7C_ARATH ABC transporter C family member 769.300%Swiss-ProtHigh
Q7GB25Arabidopsis thalianasp|Q7GB25|AB5C_ARATH ABC transporter C family member 561.500%Swiss-ProtHigh
A2XCD4Oryza sativa subsp. indicasp|A2XCD4|AB13C_ORYSI ABC transporter C family member 1361.400%Swiss-ProtHigh

JBrowse

View in Genome Browser