TkA04G267320 | RubberDandelionOmics

Gene overview

TkA04G267320

Reference: TK1151 Chr: Chr04 Coordinates: 67562591-67567609 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2369 bp · TkA04G267320|TK1151|cDNA

CTCAATGAGACTATATAGGATTGATCTTGTTATGTTTTTAGTTGAAAAAAATATATATTTCAGATGTACAGACCTCACTAAACACCAATCAGTTTCACAATTATCTAATTCGGGTCTGCCATGGATTCCGGGAGCCAAGATGAAATCGAGGATTTGTCAACTTTATCTCCTCCTCCATTGGGTCCCTTACAGATAACAGGCAACAACAATGGGTTTGTTCATGACTTCGATCTCATGGCTGCTCAAACTTACCTCAGAAA...

CDS

Download CDS FASTA

2073 bp · TkA04G267320|TK1151|CDS

ATGGATTCCGGGAGCCAAGATGAAATCGAGGATTTGTCAACTTTATCTCCTCCTCCATTGGGTCCCTTACAGATAACAGGCAACAACAATGGGTTTGTTCATGACTTCGATCTCATGGCTGCTCAAACTTACCTCAGAAACAGATCAAGCTCACAGATCGATATCCAAGACGACACATTCCCGACTAAAGATCGCCCACTTCCCATTTTTCTTAAGTTTGAAGATATAGAGTTTAAGGTGAAAGTGAGCAAAGCAACACC...

Protein

Download Protein FASTA

690 aa · TkA04G267320|TK1151|PROTEIN

MDSGSQDEIEDLSTLSPPPLGPLQITGNNNGFVHDFDLMAAQTYLRNRSSSQIDIQDDTFPTKDRPLPIFLKFEDIEFKVKVSKATPGNPVKAVMSRIVLKPKTEEDNYKQILKGITGSLGPGEILALMGPSGSGKTTLLKVIGGRLGENVKGTVTYNDVPYSPALKRRIGFVTQDDVLYPQLTVEETLIFAASLRLSGTMSQKQKYERVEVILKELGLERCRKTRVGGGFISGISGGERKRTSIGYEILVDPSLLLLDE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G267320`
TK1151 ID	TkA04G267320
OH-1004 ID	LXL04_037276
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G267320

Location Chr04:67562591-67567609 (-)

Description Similar to ABCG26: ABC transporter G family member 26

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g13220`	Mediates the transport of sporopollenin precursors (e.g. polyketides) across the tapetum plasma membrane into the anther locule for polymerization on developing microspore walls, thus being required for male fertility and pollen exine formation and patterning prior to tapetum programmed cell death.	ATP-binding cassette transporter G26 is required for male fertility and pollen exine formation in Arabidopsis.2010 · DOI: 10.1104/pp.110.161968 WBC27, an adenosine tri-phosphate-binding cassette protein, controls pollen wall formation and patterning in Arabidopsis.2011 · DOI: 10.1111/j.1744-7909.2010.01010.x An ABCG/WBC-type ABC transporter is essential for transport of sporopollenin precursors for exine formation in developing pollen.2011 · DOI: 10.1111/j.1365-313x.2010.04412.x Arabidopsis mutant of AtABCG26, an ABC transporter gene, is defective in pollen maturation.2011 · DOI: 10.1016/j.jplph.2011.05.014 ABCG26-mediated polyketide trafficking and hydroxycinnamoyl spermidines contribute to pollen wall exine formation in Arabidopsis.2014 · DOI: 10.1105/tpc.114.130484
`At5g06530`	ABC transporter G family member 22.	No verified direct reference in this release
`At3g52310`	ABC transporter G family member 27.	No verified direct reference in this release
`At1g31770`	Positive regulator of plant growth which acts as an efflux pump involved in the major root-to-shoot (acropetal) long-distance cytokinin (CK) transport via the xylem sap.	ABCG9, ABCG11 and ABCG14 ABC transporters are required for vascular development in Arabidopsis.2013 · DOI: 10.1111/tpj.12334 Arabidopsis ABCG14 protein controls the acropetal translocation of root-synthesized cytokinins.2014 · DOI: 10.1038/ncomms4274 Arabidopsis ABCG14 is essential for the root-to-shoot translocation of cytokinin.2014 · DOI: 10.1073/pnas.1321519111 Cytokinin Response Factor 6 Represses Cytokinin-Associated Genes during Oxidative Stress.2016 · DOI: 10.1104/pp.16.00415 A Role of Cytokinin Transporter in Arabidopsis Immunity.2017 · DOI: 10.1094/mpmi-01-17-0011-r
`At3g25620`	ABC transporter G family member 21.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_037276 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009414 response to water deprivation Biological Process

GO:0009555 pollen development Biological Process

GO:0009736 cytokinin-activated signaling pathway Biological Process

GO:0010115 regulation of abscisic acid biosynthetic process Biological Process

GO:0010148 transpiration Biological Process

GO:0010152 pollen maturation Biological Process

GO:0010184 cytokinin transport Biological Process

GO:0010222 stem vascular tissue pattern formation Biological Process

GO:0010584 pollen exine formation Biological Process

GO:0010588 cotyledon vascular tissue pattern formation Biological Process

GO:0030638 polyketide metabolic process Biological Process

GO:0042542 response to hydrogen peroxide Biological Process

KEGG gene cross-reference

ath:AT1G31770

ath:AT3G13220

ath:AT3G25620

ath:AT5G06530

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.766

Rank 1 · TkA04G267320 · TK1151

Cytoplasm0.135

Rank 2 · TkA04G267320 · TK1151

Endoplasmic reticulum0.087

Rank 3 · TkA04G267320 · TK1151

Lysosome / Vacuole0.072

Rank 4 · TkA04G267320 · TK1151

Golgi apparatus0.055

Rank 5 · TkA04G267320 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02367TsaE106-149 aa

PF00931NB-ARC110-143 aa

PF03193RsgA_GTPase111-151 aa

PF00005ABC_tran113-263 aa

PF13481AAA_25116-140 aa

PF25199nSTAND_NTPase5121-159 aa

PF01637ATPase_2121-156 aa

PF03215Rad17122-153 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G267320	`PF02367`	TsaE	106	149	0.0076	16.9
TkA04G267320	`PF00931`	NB-ARC	110	143	0.076	13.3
TkA04G267320	`PF03193`	RsgA_GTPase	111	151	0.036	14.6
TkA04G267320	`PF00005`	ABC_tran	113	263	1.8e-29	103.8
TkA04G267320	`PF13481`	AAA_25	116	140	0.16	12.3
TkA04G267320	`PF25199`	nSTAND_NTPase5	121	159	0.024	15.2
TkA04G267320	`PF01637`	ATPase_2	121	156	0.054	14.0
TkA04G267320	`PF03215`	Rad17	122	153	0.032	14.9
TkA04G267320	`PF13191`	AAA_16	123	168	0.0025	19.1
TkA04G267320	`PF02463`	SMC_N	124	149	4.7e-05	23.7
TkA04G267320	`PF13401`	AAA_22	124	155	0.013	16.6
TkA04G267320	`PF00437`	T2SSE	124	159	0.13	11.6
TkA04G267320	`PF13304`	AAA_21	125	143	3.2e-08	34.6
TkA04G267320	`PF13555`	AAA_29	125	140	0.14	12.7
TkA04G267320	`PF02492`	cobW	126	159	0.35	11.2
TkA04G267320	`PF05729`	NACHT	126	143	0.46	11.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LK50`	Arabidopsis thaliana	sp\|Q9LK50\|AB26G_ARATH ABC transporter G family member 26	70.800%	Swiss-Prot	High
`Q93YS4`	Arabidopsis thaliana	sp\|Q93YS4\|AB22G_ARATH ABC transporter G family member 22	45.600%	Swiss-Prot	Medium
`Q9FT51`	Arabidopsis thaliana	sp\|Q9FT51\|AB27G_ARATH ABC transporter G family member 27	44.700%	Swiss-Prot	Medium
`Q9C6W5`	Arabidopsis thaliana	sp\|Q9C6W5\|AB14G_ARATH ABC transporter G family member 14	44.200%	Swiss-Prot	Medium
`Q7XA72`	Arabidopsis thaliana	sp\|Q7XA72\|AB21G_ARATH ABC transporter G family member 21	44.400%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card