TkA04G165040 | RubberDandelionOmics

Gene overview

TkA04G165040

Reference: TK1151 Chr: Chr04 Coordinates: 42638652-42641379 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1993 bp · TkA04G165040|TK1151|cDNA

GTAACTCCCAGCCACGTGTCCCAGGACCTGTTCAGTATCCAGTATAATTTCCCTTTCTCTTATTATATAATTCCCCTTTCTCTTTCCATATATACGGATCCCACAGAAGAAATTGTTCGCAGTCTTTCGATCCGATCTCAACGCCGTTCTGCAATTTTAAGCATCTGAATTTTTGCTTCGTAGAGAAGTTAATATAAAGTAATAGTCCACCACCTGGGAATGCGGAATGATGTGTTCAAACGTTGGTAATTCCTTACATA...

CDS

Download CDS FASTA

1320 bp · TkA04G165040|TK1151|CDS

ATGGAGAATATGGGAAATATATTGATGCAAAAATATGAATTCGGGAAGATGCTTGGGCAAGGTAACTTTGCCAAAGTTTACCATGGTAGGGATTTAAAATCGGGCCAAAGTATAGCCATTAAAGTGATCGACAAAGAAAAGGTTTTAAAAGTTGGATTAATCGACCAAACAAAGCGAGAAATATCGGTGATGAAAACGGTCAAACACCCAAATATAATCCAACTTTACGAAGTCATGGCCACAAAATCCAAAATCTATTT...

Protein

Download Protein FASTA

439 aa · TkA04G165040|TK1151|PROTEIN

MENMGNILMQKYEFGKMLGQGNFAKVYHGRDLKSGQSIAIKVIDKEKVLKVGLIDQTKREISVMKTVKHPNIIQLYEVMATKSKIYFAMEYAKGGELFEKVSKGRLKEDVARKYFQQLILAVDHCHSRGVYHRDLKPENLLLDENGDLKVTDFGLSAHDTCTRLDGLFHTTCGTPAYVAPEVISRRGYDGGKSDIWSCGVILFVLLTGNLPFNDSNIIQMYRKITKADYKCPNWVTPETRRLLKKILDPNPLTRISIKKI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G165040`
TK1151 ID	TkA04G165040
OH-1004 ID	LXL04_035122
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	99.300
Protein coverage (%)	TK1151 99.544 / OH-1004 71.522 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G165040

Location Chr04:42638652-42641379 (-)

Description Similar to CIPK2: CBL-interacting protein kinase 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g45820`	CIPK serine-threonine protein kinases interact with CBL proteins.	Constitutive activation and transgenic evaluation of the function of an arabidopsis PKS protein kinase.2002 · DOI: 10.1074/jbc.m205504200

Rice

Reference gene ID	Possible function	Papers / DOI
`Os05g0332300`	CIPK serine-threonine protein kinases interact with CBL proteins.	No verified direct reference in this release
`Os07g0678600`	CIPK serine-threonine protein kinases interact with CBL proteins.	No verified direct reference in this release
`Os03g0339900`	CIPK serine-threonine protein kinases interact with CBL proteins.	No verified direct reference in this release
`Os01g0206700`	CIPK serine-threonine protein kinases interact with CBL proteins.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035122 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0007165 signal transduction Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0005634 nucleus Cellular Component

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0106310 protein serine kinase activity Molecular Function

KEGG gene cross-reference

ath:AT5G45820

dosa:Os01g0206700

dosa:Os03g0339900

dosa:Os05g0332300

dosa:Os07g0678600

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.569

Rank 1 · TkA04G165040 · TK1151

Nucleus0.369

Rank 2 · TkA04G165040 · TK1151

Cell membrane0.200

Rank 3 · TkA04G165040 · TK1151

Endoplasmic reticulum0.054

Rank 4 · TkA04G165040 · TK1151

Golgi apparatus0.047

Rank 5 · TkA04G165040 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069Pkinase12-266 aa

PF07714PK_Tyr_Ser-Thr13-262 aa

PF14531Kinase-like13-45 aa

PF03109ABC119-44 aa

PF07387Seadorna_VP733-69 aa

PF06293Kdo46-77 aa

PF03109ABC161-157 aa

PF14531Kinase-like97-215 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G165040	`PF00069`	Pkinase	12	266	9.7e-76	255.3
TkA04G165040	`PF07714`	PK_Tyr_Ser-Thr	13	262	4.9e-38	131.6
TkA04G165040	`PF14531`	Kinase-like	13	45	4.7e-07	30.1
TkA04G165040	`PF03109`	ABC1	19	44	2.1e-06	27.8
TkA04G165040	`PF07387`	Seadorna_VP7	33	69	0.18	11.5
TkA04G165040	`PF06293`	Kdo	46	77	0.005	17.0
TkA04G165040	`PF03109`	ABC1	61	157	2.1e-06	27.8
TkA04G165040	`PF14531`	Kinase-like	97	215	4.7e-07	30.1
TkA04G165040	`PF06293`	Kdo	106	147	0.005	17.0
TkA04G165040	`PF01636`	APH	119	155	0.13	12.8
TkA04G165040	`PF07387`	Seadorna_VP7	122	153	0.18	11.5
TkA04G165040	`PF03822`	NAF	313	368	1.3e-19	70.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FJ54`	Arabidopsis thaliana	sp\|Q9FJ54\|CIPKK_ARATH CBL-interacting serine/threonine-protein kinase 20	58.000%	Swiss-Prot	High
`Q5W736`	Oryza sativa subsp. japonica	sp\|Q5W736\|CIPKI_ORYSJ CBL-interacting protein kinase 18	61.500%	Swiss-Prot	High
`Q7X996`	Oryza sativa subsp. japonica	sp\|Q7X996\|CIPK2_ORYSJ CBL-interacting protein kinase 2	62.100%	Swiss-Prot	High
`Q10LQ2`	Oryza sativa subsp. japonica	sp\|Q10LQ2\|CIPKA_ORYSJ CBL-interacting protein kinase 10	57.200%	Swiss-Prot	High
`Q9LWM4`	Oryza sativa subsp. japonica	sp\|Q9LWM4\|CIPK5_ORYSJ CBL-interacting protein kinase 5	58.600%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card