TkA04G142900 | RubberDandelionOmics

Gene overview

TkA04G142900

Reference: TK1151 Chr: Chr04 Coordinates: 36950903-36952287 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1128 bp · TkA04G142900|TK1151|cDNA

ATGAAGAAAATGCTAAACTACTGCTTTTGCTGCACTTCTCCCGAAGATCAAGAACCAACGATCAGTGCCCCAAAGAAAACGGATTATCCATGGAATATGTACACCCTCAAAGAACTTGTGCACGGAACAAACAATTTCCATAACGATAACAAGATAGGTGAAGGAGGCTTTGGTAGTGTTTACTGGGGTCGAACTAGTAAATGCGCTGAGTTGGCAGTGAAACGACTCAAGTCAATAAACGCAAAAGCTGAAATGGAATT...

CDS

Download CDS FASTA

1128 bp · TkA04G142900|TK1151|CDS

ATGAAGAAAATGCTAAACTACTGCTTTTGCTGCACTTCTCCCGAAGATCAAGAACCAACGATCAGTGCCCCAAAGAAAACGGATTATCCATGGAATATGTACACCCTCAAAGAACTTGTGCACGGAACAAACAATTTCCATAACGATAACAAGATAGGTGAAGGAGGCTTTGGTAGTGTTTACTGGGGTCGAACTAGTAAATGCGCTGAGTTGGCAGTGAAACGACTCAAGTCAATAAACGCAAAAGCTGAAATGGAATT...

Protein

Download Protein FASTA

375 aa · TkA04G142900|TK1151|PROTEIN

MKKMLNYCFCCTSPEDQEPTISAPKKTDYPWNMYTLKELVHGTNNFHNDNKIGEGGFGSVYWGRTSKCAELAVKRLKSINAKAEMEFAVEVEILGRVQHKNLLGLKGFYAGGDERLIVYDYMPNHSLLTHLHGQLASDCLLDWPRRMNIAIGSAEGLAYLHHEVTPHIIHRDIKASNVLLDSDFQAKVADFGFAKLIPDGVTHMTTRVKGTLGYLAPEYAMWGKVSESCDVYSYGILVLEILSGKKPLEKLPGGIKRDII...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G142900`
TK1151 ID	TkA04G142900
OH-1004 ID	LXL04_028315
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	69.900
Protein coverage (%)	TK1151 77.067 / OH-1004 28.004 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G142900

Location Chr04:36950903-36952287 (+)

Description Similar to At3g15890: PTI1-like tyrosine-protein kinase At3g15890

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g15890`	PTI1-like tyrosine-protein kinase At3g15890.	No verified direct reference in this release
`At3g18810`	Putative proline-rich receptor-like protein kinase PERK6.	No verified direct reference in this release
`At4g34440`	Proline-rich receptor-like protein kinase PERK5.	No verified direct reference in this release
`At1g60800`	Receptor kinase acting, redundantly with other CIKs (e.g. CIK1, CIK2, CIK3, CIK5 and CIK6), as a coreceptor of CLV1, CLV2/CRN and RPK2, and required for CLAVATA-family peptides (e.g. CLV3) signaling through phosphorylation; this signaling regulates protophloem differentiation and the maintenance of shoot apical meristem (SAM) and root apical meristem (RAM) homeostasis, and acts down-stream of BRX and OPS.	No verified direct reference in this release
`At2g42960`	Probable receptor-like protein kinase At2g42960.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_028315 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0007165 signal transduction Biological Process

GO:0009611 response to wounding Biological Process

GO:0009620 response to fungus Biological Process

GO:0046777 protein autophosphorylation Biological Process

GO:0071456 cellular response to hypoxia Biological Process

GO:0005634 nucleus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0004672 protein kinase activity Molecular Function

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0004715 non-membrane spanning protein tyrosine kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0019901 protein kinase binding Molecular Function

KEGG gene cross-reference

ath:AT1G68690

ath:AT3G15890

ath:AT3G24550

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.683

Rank 1 · TkA04G142900 · TK1151

Cytoplasm0.252

Rank 2 · TkA04G142900 · TK1151

Nucleus0.225

Rank 3 · TkA04G142900 · TK1151

Endoplasmic reticulum0.041

Rank 4 · TkA04G142900 · TK1151

Golgi apparatus0.029

Rank 5 · TkA04G142900 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069Pkinase46-315 aa

PF07714PK_Tyr_Ser-Thr48-315 aa

PF03109ABC152-77 aa

PF03109ABC1158-197 aa

PF01636APH163-196 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G142900	`PF00069`	Pkinase	46	315	1.6e-44	153.0
TkA04G142900	`PF07714`	PK_Tyr_Ser-Thr	48	315	8.8e-44	150.5
TkA04G142900	`PF03109`	ABC1	52	77	0.32	10.8
TkA04G142900	`PF03109`	ABC1	158	197	0.32	10.8
TkA04G142900	`PF01636`	APH	163	196	0.22	11.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LSC2`	Arabidopsis thaliana	sp\|Q9LSC2\|Y3589_ARATH PTI1-like tyrosine-protein kinase At3g15890	51.400%	Swiss-Prot	High
`Q9LS95`	Arabidopsis thaliana	sp\|Q9LS95\|PERK6_ARATH Putative proline-rich receptor-like protein kinase PERK6	43.900%	Swiss-Prot	Medium
`Q8GX23`	Arabidopsis thaliana	sp\|Q8GX23\|PERK5_ARATH Proline-rich receptor-like protein kinase PERK5	44.600%	Swiss-Prot	Medium
`Q93ZS4`	Arabidopsis thaliana	sp\|Q93ZS4\|CIK1_ARATH Protein CLAVATA3 INSENSITIVE RECEPTOR KINASE 1	43.900%	Swiss-Prot	Medium
`Q9SJG2`	Arabidopsis thaliana	sp\|Q9SJG2\|Y2296_ARATH Probable receptor-like protein kinase At2g42960	41.400%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card