TkA04G104970 | RubberDandelionOmics

Gene overview

TkA04G104970

Reference: TK1151 Chr: Chr04 Coordinates: 27321099-27332347 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

7799 bp · TkA04G104970|TK1151|cDNA

AACTCCCAGTCTTGGACCCATGGTCTCTCTCATTTATGTATATCTTTAAGGCGCCTCACCAAAAAACCAACCAACAAACCAAACCCCAACCAAACCACACTTAATTCCAACCCCCATTCCATCCCCCCTACAACTACTCGCATCTCTCCAGATTTCCGCCATTCCAGTTTCTTCACAATCTCTTCTAATCTCTTCTTCTTTTCAATTCTCTCTCTGCTGTTCAAAGCAGCTTCAAAAAGACAAAAACTCTATTCGTCTTT...

CDS

Download CDS FASTA

1776 bp · TkA04G104970|TK1151|CDS

ATGGAGCATTTAGTGTACCCTAATCCAGCTGCCTACAGAGATAAACTAATACGGTTTTCTACCCTCAACCACACAAATTACTCCGAGTTAGCATTGAAGGCAAGTCAACTACTAGAACAAACTAAACTAAGTGAACTTCGTTCAAGTATAGCTAGAAGTCTCTCAGAACTAGAAATGTTCACAGAAGAAGGTGAAAACATGGACACCCCTAAAAGAAAAAGCGCCATTAATGAAAGAATGGAGGATATTGTTAGCGCCCC...

Protein

Download Protein FASTA

591 aa · TkA04G104970|TK1151|PROTEIN

MEHLVYPNPAAYRDKLIRFSTLNHTNYSELALKASQLLEQTKLSELRSSIARSLSELEMFTEEGENMDTPKRKSAINERMEDIVSAPLAVEDALVGLFDHSDHTLQRRVVETYVRRLYQPYLAKGSVRMQWHRSGLIASWQFMEGHIEEVNSSEYEMTETPLVEKKWGAMVIIKSLQFLPDVIKAALKETTNNSNGNHGNMMHIALAGINNQMSLLQDSGDEDQAQERVNRLAKILKDKEVSSCLKSAGYGVISCIIQRD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G104970`
TK1151 ID	TkA04G104970
OH-1004 ID	LXL04_035827
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	98.100
Protein coverage (%)	TK1151 90.525 / OH-1004 22.626 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G104970

Location Chr04:27321099-27332347 (-)

Description Similar to ACC1: Acetyl-CoA carboxylase 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g36160`	Multifunctional enzyme that catalyzes the carboxylation of acetyl-CoA, forming malonyl-CoA, which is used in the plastid for fatty acid synthesis and in the cytosol in various biosynthetic pathways including fatty acid elongation.	Multifunctional acetyl-CoA carboxylase 1 is essential for very long chain fatty acid elongation and embryo development in Arabidopsis.2003 · DOI: 10.1046/j.1365-313x.2003.016010.x gurke and pasticcino3 mutants affected in embryo development are impaired in acetyl-CoA carboxylase.2004 · DOI: 10.1038/sj.embor.7400124 The GURKE gene encoding an acetyl-CoA carboxylase is required for partitioning the embryo apex into three subregions in Arabidopsis.2004 · DOI: 10.1093/pcp/pch148 Targeting of the Arabidopsis homomeric acetyl-coenzyme A carboxylase to plastids of rapeseeds.1997 · DOI: 10.1104/pp.113.1.75 The PASTICCINO genes of Arabidopsis thaliana are involved in the control of cell division and differentiation.1998 · DOI: 10.1242/dev.125.5.909
`At1g36180`	Multifunctional enzyme that catalyzes the carboxylation of acetyl-CoA, forming malonyl-CoA, which is used in the plastid for fatty acid synthesis and in the cytosol in various biosynthetic pathways including fatty acid elongation.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os10g0363300`	Multifunctional enzyme that catalyzes the carboxylation of acetyl-CoA, forming malonyl-CoA, which is used in the plastid for fatty acid synthesis and in the cytosol in various biosynthetic pathways including fatty acid elongation.	No verified direct reference in this release
`Os05g0295300`	Multifunctional enzyme that catalyzes the carboxylation of acetyl-CoA, forming malonyl-CoA, which is used in the plastid for fatty acid synthesis and in the cytosol in various biosynthetic pathways including fatty acid elongation.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035827 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006633 fatty acid biosynthetic process Biological Process

GO:0009735 response to cytokinin Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0009933 meristem structural organization Biological Process

GO:0010072 primary shoot apical meristem specification Biological Process

GO:0030497 fatty acid elongation Biological Process

GO:0048364 root development Biological Process

GO:0048367 shoot system development Biological Process

GO:0101026 mitotic nuclear membrane biogenesis Biological Process

GO:2001295 malonyl-CoA biosynthetic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

KEGG gene cross-reference

ath:AT1G36160

ath:AT1G36180

dosa:Os05g0295300

dosa:Os10g0363300

osa:4348450

spo:2543344

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.457

Rank 1 · TkA04G104970 · TK1151

Cytoplasm0.340

Rank 2 · TkA04G104970 · TK1151

Mitochondrion0.155

Rank 3 · TkA04G104970 · TK1151

Cell membrane0.073

Rank 4 · TkA04G104970 · TK1151

Endoplasmic reticulum0.057

Rank 5 · TkA04G104970 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08326ACC_central11-504 aa

PF28047HrpE-like202-234 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G104970	`PF08326`	ACC_central	11	504	6.8e-90	303.0
TkA04G104970	`PF28047`	HrpE-like	202	234	0.21	12.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q38970`	Arabidopsis thaliana	sp\|Q38970\|ACC1_ARATH Acetyl-CoA carboxylase 1	69.800%	Swiss-Prot	High
`F4I1L3`	Arabidopsis thaliana	sp\|F4I1L3\|ACC2_ARATH Acetyl-CoA carboxylase 2	66.900%	Swiss-Prot	High
`Q8S6N5`	Oryza sativa subsp. japonica	sp\|Q8S6N5\|ACC1_ORYSJ Acetyl-CoA carboxylase 1	61.900%	Swiss-Prot	High
`B9FK36`	Oryza sativa subsp. japonica	sp\|B9FK36\|ACC2_ORYSJ Acetyl-CoA carboxylase 2	54.400%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card