TkA04G076880 | RubberDandelionOmics

Gene overview

TkA04G076880

Reference: TK1151 Chr: Chr04 Coordinates: 20258604-20260055 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1355 bp · TkA04G076880|TK1151|cDNA

GATACTCTCTTCATCCAACCGCCACAATTTCCTCGCTTATCTCATCCCTTCACACCTCCAACTCTATACATCACGCCACACTCCTCCTCACCCACTACACACAACCCACCACCACCAATGGCAACCACCACCGCCGCCGCCGCCTCCTCCTTCATCGGAACCCGTCTCCCAGACCGACATTCCAACTCCGGCAGAGTTTCATCCAGATTCGGATTCGGAAAGAAGAAAGCCGCCCCCAAAAAAGCAGCCAGAACCGTAAC...

CDS

Download CDS FASTA

978 bp · TkA04G076880|TK1151|CDS

GATACTCTCTTCATCCAACCGCCACAATTTCCTCGCTTATCTCATCCCTTCACACCTCCAACTCTATACATCACGCCACACTCCTCCTCACCCACTACACACAACCCACCACCACCAATGGCAACCACCACCGCCGCCGCCGCCTCCTCCTTCATCGGAACCCGTCTCCCAGACCGACATTCCAACTCCGGCAGAGTTTCATCCAGATTCGGATTCGGAAAGAAGAAAGCCGCCCCCAAAAAAGCAGCCAGAACCGTAAC...

Protein

Download Protein FASTA

325 aa · TkA04G076880|TK1151|PROTEIN

DTLFIQPPQFPRLSHPFTPPTLYITPHSSSPTTHNPPPPMATTTAAAASSFIGTRLPDRHSNSGRVSSRFGFGKKKAAPKKAARTVTSDRPLWYPGAKAPEYLDGSLVGDYGFDPFGLGKPAEYLQFDLDSLDQNLAKNLAGDVIGTRFEDSDVKSTPFQPYSEVFGLQRFRECELIHGRWAMLATLGALTVESVTGVTWQDAGKVELIDGSSYLGQPLPFSITTLIWIEVLIIGYIEFQRNAELEPEKRLYPGGPFDPL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G076880`
TK1151 ID	TkA04G076880
OH-1004 ID	LXL04_036090
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	99.300
Protein coverage (%)	TK1151 85.231 / OH-1004 96.853 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G076880

Location Chr04:20258604-20260055 (+)

Description Similar to LHCB4.2: Chlorophyll a-b binding protein CP29.2, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g01530`	The light-harvesting complex (LHC) functions as a light receptor, it captures and delivers excitation energy to photosystems with which it is closely associated.	No verified direct reference in this release
`At3g08940`	The light-harvesting complex (LHC) functions as a light receptor, it captures and delivers excitation energy to photosystems with which it is closely associated.	No verified direct reference in this release
`At2g40100`	The light-harvesting complex (LHC) functions as a light receptor, it captures and delivers excitation energy to photosystems with which it is closely associated.	No verified direct reference in this release
`At4g10340`	The light-harvesting complex (LHC) functions as a light receptor, it captures and delivers excitation energy to photosystems with which it is closely associated.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036090 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009409 response to cold Biological Process

GO:0009416 response to light stimulus Biological Process

GO:0009644 response to high light intensity Biological Process

GO:0009645 response to low light intensity stimulus Biological Process

GO:0009765 photosynthesis, light harvesting Biological Process

GO:0009768 photosynthesis, light harvesting in photosystem I Biological Process

GO:0005794 Golgi apparatus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009503 thylakoid light-harvesting complex Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009522 photosystem I Cellular Component

KEGG gene cross-reference

ath:AT2G40100

ath:AT3G08940

ath:AT3G54890

ath:AT5G01530

cre:CHLRE_17g720250v5

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.987

Rank 1 · TkA04G076880 · TK1151

Mitochondrion0.021

Rank 2 · TkA04G076880 · TK1151

Cytoplasm0.012

Rank 3 · TkA04G076880 · TK1151

Nucleus0.010

Rank 4 · TkA04G076880 · TK1151

Cell membrane0.008

Rank 5 · TkA04G076880 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00504Chloroa_b-bind99-294 aa

PF31213HliA174-197 aa

PF31213HliA275-300 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G076880	`PF00504`	Chloroa_b-bind	99	294	3.5e-42	145.4
TkA04G076880	`PF31213`	HliA	174	197	0.00012	22.7
TkA04G076880	`PF31213`	HliA	275	300	0.00012	22.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q07473`	Arabidopsis thaliana	sp\|Q07473\|CB4A_ARATH Chlorophyll a-b binding protein CP29.1, chloroplastic	84.500%	Swiss-Prot	High
`Q9XF88`	Arabidopsis thaliana	sp\|Q9XF88\|CB4B_ARATH Chlorophyll a-b binding protein CP29.2, chloroplastic	85.100%	Swiss-Prot	High
`Q9S7W1`	Arabidopsis thaliana	sp\|Q9S7W1\|CB4C_ARATH Chlorophyll a-b binding protein CP29.3, chloroplastic	70.800%	Swiss-Prot	High
`Q9XF89`	Arabidopsis thaliana	sp\|Q9XF89\|CB5_ARATH Chlorophyll a-b binding protein CP26, chloroplastic	35.200%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card