LXL04_036090 | RubberDandelionOmics

Gene overview

LXL04_036090

Reference: OH-1004 Chr: Chr08 Coordinates: 35513466-35514537 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

975 bp · LXL04_036090|LXL04_036090|OH1004|cDNA

GATACTCTCTTCATCCAACCGCCACAATTTCCTCGCTTATCTCATCCCTTCACACCTCCAACTCTATACATCACGCCACACTCCTCACCAACTACACACAACCCACCACCACCAATGGCAaccaccgccgccgccgccgcctCCTCCTTCATCGGAACCCGTCTCCCAGACCTACATTCCAACTCCGGCAGAGTTTCAGCCAGATTCGGATTCGGAAAGAAGAAAGCCGCCCCCAAAAAAGCAGCCAGAACCGTAACTTC...

CDS

Download CDS FASTA

861 bp · LXL04_036090|LXL04_036090|OH1004|CDS

ATGGCAACCACCGCCGCCGCCGCCGCCTCCTCCTTCATCGGAACCCGTCTCCCAGACCTACATTCCAACTCCGGCAGAGTTTCAGCCAGATTCGGATTCGGAAAGAAGAAAGCCGCCCCCAAAAAAGCAGCCAGAACCGTAACTTCTGATCGTCCATTATGGTACCCCGGCGCAAAAGCACCGGAGTATCTAGACGGGAGTCTGGTCGGAGACTACGGGTTTGACCCATTCGGTTTGGGTAAACCGGCTGAGTATTTACA...

Protein

Download Protein FASTA

286 aa · LXL04_036090|LXL04_036090|OH1004|PROTEIN

MATTAAAAASSFIGTRLPDLHSNSGRVSARFGFGKKKAAPKKAARTVTSDRPLWYPGAKAPEYLDGSLVGDYGFDPFGLGKPAEYLQFDLDSLDQNLAKNLAGDVIGTRFEDSDVKSTPFQPYSEVFGLQRFRECELIHGRWAMLATLGALTVESVTGVTWQDAGKVELIDGSSYLGQPLPFSITTLIWIEVLIIGYIEFQRNAELEPEKRLYPGGPFDPLNLAADPEKKAILQLAEIKHARLAMVGFLGFAVQAAATGK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_036090`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_036090

Location Chr08:35513466-35514537 (+)

Description Similar to LHCB4.2: Chlorophyll a-b binding protein CP29.2, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g08940`	The light-harvesting complex (LHC) functions as a light receptor, it captures and delivers excitation energy to photosystems with which it is closely associated.	No verified direct reference in this release
`At5g01530`	The light-harvesting complex (LHC) functions as a light receptor, it captures and delivers excitation energy to photosystems with which it is closely associated.	No verified direct reference in this release
`At2g40100`	The light-harvesting complex (LHC) functions as a light receptor, it captures and delivers excitation energy to photosystems with which it is closely associated.	No verified direct reference in this release
`At3g54890`	The light-harvesting complex (LHC) functions as a light receptor, it captures and delivers excitation energy to photosystems with which it is closely associated.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036090 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009409 response to cold Biological Process

GO:0009416 response to light stimulus Biological Process

GO:0009644 response to high light intensity Biological Process

GO:0009645 response to low light intensity stimulus Biological Process

GO:0009765 photosynthesis, light harvesting Biological Process

GO:0009768 photosynthesis, light harvesting in photosystem I Biological Process

GO:0005794 Golgi apparatus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009503 thylakoid light-harvesting complex Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009522 photosystem I Cellular Component

KEGG gene cross-reference

ath:AT2G40100

ath:AT3G08940

ath:AT3G54890

ath:AT5G01530

cre:CHLRE_17g720250v5

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.988

Rank 1 · LXL04_036090 · OH-1004

Mitochondrion0.021

Rank 2 · LXL04_036090 · OH-1004

Cytoplasm0.011

Rank 3 · LXL04_036090 · OH-1004

Nucleus0.008

Rank 4 · LXL04_036090 · OH-1004

Cell membrane0.008

Rank 5 · LXL04_036090 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00504.29Chloroa_b-bind60-255 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_036090	`PF00504.29`	Chloroa_b-bind	60	255	2.3e-42	146.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9XF88`	Arabidopsis thaliana	Chlorophyll a-b binding protein CP29.2, chloroplastic	86.029%	Swiss-Prot	strong database homology
`Q07473`	Arabidopsis thaliana	Chlorophyll a-b binding protein CP29.1, chloroplastic	85.036%	Swiss-Prot	strong database homology
`Q9S7W1`	Arabidopsis thaliana	Chlorophyll a-b binding protein CP29.3, chloroplastic	71.004%	Swiss-Prot	strong database homology
`Q01667`	Arabidopsis thaliana	Chlorophyll a-b binding protein 6, chloroplastic	40.086%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card