RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA04G040380
Reference: TK1151 Chr: Chr04 Coordinates: 10811490-10813831 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

1870 bp · TkA04G040380|TK1151|cDNA

CAAACGCGTATTCGCGCGCTTTCTTATCATCTTCCTGGATCTTTCGCTCAACGCCCAATCTGCTTTTCTATATAAATTACTCTTCAAATCACTCATCTCTTTCTCGATTTATACAAAAATTCCACCTGTTAGAAAGAGAAAGAGAAAAAGAAAGAGAGATACATCTTGATCTTGCTACGGAATCTGTTACAGTAAACTAATGGCGGACTTGAACGGAGGAGTTCAGTACACGGACTTTCCGGCGGTGTCGACATACGGAG...

CDS

Download CDS FASTA

1119 bp · TkA04G040380|TK1151|CDS

ATGGCGGACTTGAACGGAGGAGTTCAGTACACGGACTTTCCGGCGGTGTCGACATACGGAGGCCAGTTCGTTCGGTACAACATATTCAGTAATGAATTCGAGATCACAGCCAAATACGTTCCTCCTATTATGCCTATTGGCCGTGGTGCTTATGGAATCGTCTGCTCGATGTTGAATTCGGAGACGAATGAGATGGTTGCTATGAAGAAGATCATGAATGCTTTTGACAATTACATGGATGCTAAGAGAACGCTTCGTGA...

Protein

Download Protein FASTA

372 aa · TkA04G040380|TK1151|PROTEIN

MADLNGGVQYTDFPAVSTYGGQFVRYNIFSNEFEITAKYVPPIMPIGRGAYGIVCSMLNSETNEMVAMKKIMNAFDNYMDAKRTLREIKLLRHLDHENVVALKDVVPPPVRREFSDVYIATELMDTDLHQIIRSNQNLSEEHCQYFLYQLLRGLKYIHSAKVIHRDLKPSNLLLNANCDLKICDFGLARPNADNDFMTEYVVTRWYRAPELLLNSSDYSAAIDVWSVGCIYMELMNRKPLFPGKDHVHQMRLLTELLGTP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA04G040380
TK1151 IDTkA04G040380
OH-1004 IDLXL04_036503
Relationship / confidenceMulti Source To Oh1004 / Complex relationship
Protein identity (%)100.000
Protein coverage (%)TK1151 100.000 / OH-1004 100.000
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA04G040380
LocationChr04:10811490-10813831 (-)
DescriptionSimilar to MPK3: Mitogen-activated protein kinase 3
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At3g45640 Involved in oxidative stress-mediated signaling cascade (such as ozone).
MAP kinase signalling cascade in Arabidopsis innate immunity.2002 · DOI: 10.1038/415977a
RNA interference-based (RNAi) suppression of AtMPK6, an Arabidopsis mitogen-activated protein kinase, results in hypersensitivity to ozone and misregulation of AtMPK3.2005 · DOI: 10.1016/j.envpol.2005.04.017
Stomatal development and patterning are regulated by environmentally responsive mitogen-activated protein kinases in Arabidopsis.2007 · DOI: 10.1105/tpc.106.048298
Dual control of nuclear EIN3 by bifurcate MAPK cascades in C2H4 signalling.2008 · DOI: 10.1038/nature06543
A fungal-responsive MAPK cascade regulates phytoalexin biosynthesis in Arabidopsis.2008 · DOI: 10.1073/pnas.0711301105
The Arabidopsis protein kinase Pto-interacting 1-4 is a common target of the oxidative signal-inducible 1 and mitogen-activated protein kinases.2011 · DOI: 10.1111/j.1742-4658.2011.08033.x
Arabidopsis MKK4 mediates osmotic-stress response via its regulation of MPK3 activity.2011 · DOI: 10.1016/j.bbrc.2011.07.064
A MAPK cascade downstream of ERECTA receptor-like protein kinase regulates Arabidopsis inflorescence architecture by promoting localized cell proliferation.2012 · DOI: 10.1105/tpc.112.104695
Arabidopsis LIP5, a positive regulator of multivesicular body biogenesis, is a critical target of pathogen-responsive MAPK cascade in plant basal defense.2014 · DOI: 10.1371/journal.ppat.1004243
The BASL polarity protein controls a MAPK signaling feedback loop in asymmetric cell division.2015 · DOI: 10.1016/j.devcel.2015.02.022

Rice

Reference gene IDPossible functionPapers / DOI
UniProt: A2XFC8 Involved in disease resistance and abiotic stress tolerance signaling pathways. No verified direct reference in this release
Os03g0285800 Involved in disease resistance and abiotic stress tolerance signaling pathways.
Disease resistance and abiotic stress tolerance in rice are inversely modulated by an abscisic acid-inducible mitogen-activated protein kinase.2003 · DOI: 10.1105/tpc.008714
Direct phosphorylation and activation of a mitogen-activated protein kinase by a calcium-dependent protein kinase in rice.2014 · DOI: 10.1105/tpc.114.126441
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_036503 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006468 protein phosphorylation Biological Process
GO:0006970 response to osmotic stress Biological Process
GO:0006979 response to oxidative stress Biological Process
GO:0007165 signal transduction Biological Process
GO:0009409 response to cold Biological Process
GO:0009555 pollen development Biological Process
GO:0009611 response to wounding Biological Process
GO:0009617 response to bacterium Biological Process
GO:0009626 plant-type hypersensitive response Biological Process
GO:0009738 abscisic acid-activated signaling pathway Biological Process
GO:0009875 pollen-pistil interaction Biological Process
GO:0010120 camalexin biosynthetic process Biological Process
KEGG gene cross-reference
ath:AT3G45640
cann:107873437
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.631
Rank 1 · TkA04G040380 · TK1151
Cytoplasm0.587
Rank 2 · TkA04G040380 · TK1151
Cell membrane0.061
Rank 3 · TkA04G040380 · TK1151
Mitochondrion0.039
Rank 4 · TkA04G040380 · TK1151
Endoplasmic reticulum0.027
Rank 5 · TkA04G040380 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF21766Dit_C5-79 aa
PF00069Pkinase45-326 aa
PF07714PK_Tyr_Ser-Thr46-237 aa
PF06293Kdo75-178 aa
PF01636APH81-160 aa
PF01163RIO183-186 aa
PF14531Kinase-like84-100 aa
PF04281Tom2297-120 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA04G040380PF21766Dit_C5790.02115.3
TkA04G040380PF00069Pkinase453267e-71239.4
TkA04G040380PF07714PK_Tyr_Ser-Thr462376.6e-32111.5
TkA04G040380PF06293Kdo751782.5e-0524.5
TkA04G040380PF01636APH811600.03414.6
TkA04G040380PF01163RIO1831860.03614.4
TkA04G040380PF14531Kinase-like841000.06613.2
TkA04G040380PF04281Tom22971200.2811.7
TkA04G040380PF13095FTA21071870.2111.9
TkA04G040380PF03109ABC11341910.001318.7
TkA04G040380PF14531Kinase-like1372280.06613.2
TkA04G040380PF01636APH1621880.03414.6
TkA04G040380PF12330Haspin_kinase1631940.01515.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q39023Arabidopsis thalianasp|Q39023|MPK3_ARATH Mitogen-activated protein kinase 380.600%Swiss-ProtHigh
A2XFC8Oryza sativa subsp. indicasp|A2XFC8|MPK5_ORYSI Mitogen-activated protein kinase 572.900%Swiss-ProtHigh
Q10N20Oryza sativa subsp. japonicasp|Q10N20|MPK5_ORYSJ Mitogen-activated protein kinase 572.900%Swiss-ProtHigh

JBrowse

View in Genome Browser