LXL04_036503 | RubberDandelionOmics

Gene overview

LXL04_036503

Reference: OH-1004 Chr: Chr08 Coordinates: 43541605-43543195 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1119 bp · LXL04_036503|LXL04_036503|OH1004|cDNA

ATGGCGGACTTGAACGGAGGAGTTCAGTACACGGACTTTCCGGCGGTGTCGACATACGGAGGCCAGTTCGTTCGGTACAACATATTCAGTAATGAATTCGAGATCACAGCCAAATACGTTCCTCCTATTATGCCTATTGGCCGTGGTGCTTATGGAATCGTCTGCTCGATGTTGAATTCGGAGACGAATGAGATGGTTGCTATGAAGAAGATCATGAATGCTTTTGACAATTACATGGATGCTAAGAGAACGCTTCGTGA...

CDS

Download CDS FASTA

1119 bp · LXL04_036503|LXL04_036503|OH1004|CDS

ATGGCGGACTTGAACGGAGGAGTTCAGTACACGGACTTTCCGGCGGTGTCGACATACGGAGGCCAGTTCGTTCGGTACAACATATTCAGTAATGAATTCGAGATCACAGCCAAATACGTTCCTCCTATTATGCCTATTGGCCGTGGTGCTTATGGAATCGTCTGCTCGATGTTGAATTCGGAGACGAATGAGATGGTTGCTATGAAGAAGATCATGAATGCTTTTGACAATTACATGGATGCTAAGAGAACGCTTCGTGA...

Protein

Download Protein FASTA

372 aa · LXL04_036503|LXL04_036503|OH1004|PROTEIN

MADLNGGVQYTDFPAVSTYGGQFVRYNIFSNEFEITAKYVPPIMPIGRGAYGIVCSMLNSETNEMVAMKKIMNAFDNYMDAKRTLREIKLLRHLDHENVVALKDVVPPPVRREFSDVYIATELMDTDLHQIIRSNQNLSEEHCQYFLYQLLRGLKYIHSAKVIHRDLKPSNLLLNANCDLKICDFGLARPNADNDFMTEYVVTRWYRAPELLLNSSDYSAAIDVWSVGCIYMELMNRKPLFPGKDHVHQMRLLTELLGTP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_036503`
TK1151 ID	TkA04G040380
OH-1004 ID	LXL04_036503
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_036503

Location Chr08:43541605-43543195 (+)

Description Similar to MPK3: Mitogen-activated protein kinase 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g45640`	Involved in oxidative stress-mediated signaling cascade (such as ozone).	MAP kinase signalling cascade in Arabidopsis innate immunity.2002 · DOI: 10.1038/415977a RNA interference-based (RNAi) suppression of AtMPK6, an Arabidopsis mitogen-activated protein kinase, results in hypersensitivity to ozone and misregulation of AtMPK3.2005 · DOI: 10.1016/j.envpol.2005.04.017 Stomatal development and patterning are regulated by environmentally responsive mitogen-activated protein kinases in Arabidopsis.2007 · DOI: 10.1105/tpc.106.048298 Dual control of nuclear EIN3 by bifurcate MAPK cascades in C2H4 signalling.2008 · DOI: 10.1038/nature06543 A fungal-responsive MAPK cascade regulates phytoalexin biosynthesis in Arabidopsis.2008 · DOI: 10.1073/pnas.0711301105 The Arabidopsis protein kinase Pto-interacting 1-4 is a common target of the oxidative signal-inducible 1 and mitogen-activated protein kinases.2011 · DOI: 10.1111/j.1742-4658.2011.08033.x Arabidopsis MKK4 mediates osmotic-stress response via its regulation of MPK3 activity.2011 · DOI: 10.1016/j.bbrc.2011.07.064 A MAPK cascade downstream of ERECTA receptor-like protein kinase regulates Arabidopsis inflorescence architecture by promoting localized cell proliferation.2012 · DOI: 10.1105/tpc.112.104695 Arabidopsis LIP5, a positive regulator of multivesicular body biogenesis, is a critical target of pathogen-responsive MAPK cascade in plant basal defense.2014 · DOI: 10.1371/journal.ppat.1004243 The BASL polarity protein controls a MAPK signaling feedback loop in asymmetric cell division.2015 · DOI: 10.1016/j.devcel.2015.02.022

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036503 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006468 protein phosphorylation Biological Process

GO:0006970 response to osmotic stress Biological Process

GO:0006979 response to oxidative stress Biological Process

GO:0007165 signal transduction Biological Process

GO:0009409 response to cold Biological Process

GO:0009555 pollen development Biological Process

GO:0009611 response to wounding Biological Process

GO:0009617 response to bacterium Biological Process

GO:0009626 plant-type hypersensitive response Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009875 pollen-pistil interaction Biological Process

GO:0010120 camalexin biosynthetic process Biological Process

KEGG gene cross-reference

ath:AT3G45640

cann:107873437

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.631

Rank 1 · LXL04_036503 · OH-1004

Cytoplasm0.587

Rank 2 · LXL04_036503 · OH-1004

Cell membrane0.061

Rank 3 · LXL04_036503 · OH-1004

Mitochondrion0.039

Rank 4 · LXL04_036503 · OH-1004

Endoplasmic reticulum0.027

Rank 5 · LXL04_036503 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069.32Pkinase45-326 aa

PF07714.24PK_Tyr_Ser-Thr46-237 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_036503	`PF00069.32`	Pkinase	45	326	7e-71	239.4
LXL04_036503	`PF07714.24`	PK_Tyr_Ser-Thr	46	237	6.6e-32	111.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q39023`	Arabidopsis thaliana	Mitogen-activated protein kinase 3	80.381%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card