TkA04G037300 | RubberDandelionOmics

Gene overview

TkA04G037300

Reference: TK1151 Chr: Chr04 Coordinates: 10002574-10007529 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

414 bp · TkA04G037300|TK1151|cDNA

TGGATTCTCCGTGTTCCTTACTCTGCTGTTGAAGCTATTGTTTGGTCTCTTATTGTTTATTATAGCGTCGGCTTTTCCCCTAGTGTAGGAAGGTTTTTTGGTTACGTGTTTGTTCTGTTTTCAATGCACCAGATGGCGTTAGGTCTGTTTCGTACATTGCCTGTAGTTGCTAGAAATGTCATAATTGCTAATACTTTTGGTTCGGCTGCCTTGCTTGTGGTGTTCTTGCTTGGTGGATTTATCATGCCCAAAGATATGAT...

CDS

Download CDS FASTA

2061 bp · TkA04G037300|TK1151|CDS

TCTATCTTAACTTCTTGTTTATTAAACTCCAATTTTGCCACGTTGCAGAAGCTTATTGGTACAAATACTACCTTAGGCTACACTGTTCTTCAGTTCCATGATCTGCCTACCAATGATAACTGGTACTGGATTGGAGTTGGTGCTTTGTTACTATACGCTGTCGTTTTCAACATCATAGTGACTCTCAGTTTGGCTTATCTTAATCCTCTAAAAAACGCACAAATAGTTCCACCTGATGCTAGCGATCAAACACCATCTTC...

Protein

Download Protein FASTA

686 aa · TkA04G037300|TK1151|PROTEIN

SILTSCLLNSNFATLQKLIGTNTTLGYTVLQFHDLPTNDNWYWIGVGALLLYAVVFNIIVTLSLAYLNPLKNAQIVPPDASDQTPSSIPDNSSRRHGMTLPFKPLSMSFHNVNYFVDMPKDMNLEGVPERKLQLLSDVSGVFLPGVLTALMGSSGAGKTTLLDVLAGRKTGGYIEGEISISGFQKEQSTFARVSGYVEQNDIHSPQVTVIESLLFSAFLRLPPDVNEKQRREFVDGVMKLVELDNLRDALVGLPGSTGLS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G037300`
TK1151 ID	TkA04G037300
OH-1004 ID	LXL04_036556
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	98.900
Protein coverage (%)	TK1151 94.898 / OH-1004 76.860 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G037300

Location Chr04:10002574-10007529 (+)

Description Similar to ABCG31: ABC transporter G family member 31

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g29940`	Together with ABCG25, export abscisic acid (ABA) from the endosperm to deliver it to the embryo via ABCG30 and ABCG40-mediated import to suppress radicle extension and subsequent embryonic growth.	The role of Arabidopsis ABCG9 and ABCG31 ATP binding cassette transporters in pollen fitness and the deposition of steryl glycosides on the pollen coat.2014 · DOI: 10.1105/tpc.113.118935 Abscisic acid transporters cooperate to control seed germination.2015 · DOI: 10.1038/ncomms9113
`At3g16340`	May be a general defense protein.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os10g0205500`	May be a general defense protein.	No verified direct reference in this release
`UniProt: A2WSH0`	May be a general defense protein.	No verified direct reference in this release
`Os01g0609300`	May be a general defense protein.	No verified direct reference in this release
`Os01g0177900`	May be a general defense protein.	No verified direct reference in this release
`Os06g0554800`	May be a general defense protein.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036556 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0010208 pollen wall assembly Biological Process

GO:0010496 intercellular transport Biological Process

GO:0015850 organic hydroxy compound transport Biological Process

GO:0048581 negative regulation of post-embryonic development Biological Process

GO:0055085 transmembrane transport Biological Process

GO:0080168 abscisic acid transport Biological Process

GO:0140352 export from cell Biological Process

GO:1901140 p-coumaryl alcohol transport Biological Process

GO:1901141 regulation of lignin biosynthetic process Biological Process

GO:1901656 glycoside transport Biological Process

GO:0005739 mitochondrion Cellular Component

KEGG gene cross-reference

ath:AT2G29940

ath:AT3G16340

dosa:Os10g0205500

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.368

Rank 1 · TkA04G037300 · TK1151

Lysosome / Vacuole0.272

Rank 2 · TkA04G037300 · TK1151

Endoplasmic reticulum0.209

Rank 3 · TkA04G037300 · TK1151

Cytoplasm0.122

Rank 4 · TkA04G037300 · TK1151

Golgi apparatus0.117

Rank 5 · TkA04G037300 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08370PDR_assoc21-75 aa

PF01061ABC2_membrane49-62 aa

PF00005ABC_tran136-287 aa

PF13481AAA_25139-165 aa

PF03193RsgA_GTPase143-169 aa

PF13304AAA_21147-166 aa

PF13555AAA_29147-164 aa

PF02463SMC_N147-165 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G037300	`PF08370`	PDR_assoc	21	75	1.9e-21	76.3
TkA04G037300	`PF01061`	ABC2_membrane	49	62	4.9e-57	193.6
TkA04G037300	`PF00005`	ABC_tran	136	287	1.2e-20	75.2
TkA04G037300	`PF13481`	AAA_25	139	165	0.06	13.7
TkA04G037300	`PF03193`	RsgA_GTPase	143	169	0.0098	16.4
TkA04G037300	`PF13304`	AAA_21	147	166	7e-07	30.2
TkA04G037300	`PF13555`	AAA_29	147	164	0.014	15.9
TkA04G037300	`PF02463`	SMC_N	147	165	0.048	13.8
TkA04G037300	`PF00004`	AAA	150	215	0.37	12.0
TkA04G037300	`PF13304`	AAA_21	266	320	7e-07	30.2
TkA04G037300	`PF02463`	SMC_N	267	326	0.048	13.8
TkA04G037300	`PF19055`	ABC2_membrane_7	316	375	1.2e-07	31.7
TkA04G037300	`PF01061`	ABC2_membrane	433	645	4.9e-57	193.6
TkA04G037300	`PF19055`	ABC2_membrane_7	474	599	1.2e-07	31.7
TkA04G037300	`PF08370`	PDR_assoc	564	579	1.9e-21	76.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q7PC88`	Arabidopsis thaliana	sp\|Q7PC88\|AB31G_ARATH ABC transporter G family member 31	71.400%	Swiss-Prot	High
`Q94A18`	Arabidopsis thaliana	sp\|Q94A18\|AB29G_ARATH ABC transporter G family member 29	60.400%	Swiss-Prot	High
`Q8S628`	Oryza sativa subsp. japonica	sp\|Q8S628\|AB51G_ORYSJ ABC transporter G family member 51	65.800%	Swiss-Prot	High
`A2WSH0`	Oryza sativa subsp. indica	sp\|A2WSH0\|AB36G_ORYSI ABC transporter G family member 36	59.000%	Swiss-Prot	High
`Q0JLC5`	Oryza sativa subsp. japonica	sp\|Q0JLC5\|AB36G_ORYSJ ABC transporter G family member 36	59.000%	Swiss-Prot	High
`Q8GU87`	Oryza sativa subsp. japonica	sp\|Q8GU87\|AB31G_ORYSJ ABC transporter G family member 31	48.600%	Swiss-Prot	Medium
`Q5Z9S8`	Oryza sativa subsp. japonica	sp\|Q5Z9S8\|AB42G_ORYSJ ABC transporter G family member 42	50.800%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card