LXL04_036556 | RubberDandelionOmics

Gene overview

LXL04_036556

Reference: OH-1004 Chr: Chr08 Coordinates: 44413071-44417036 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2544 bp · LXL04_036556|LXL04_036556|OH1004|cDNA

ATGATGTTCAATGGGTTTTCAGAGCTCCCATTAATGATATTTCGGTTACCTGTTTTTTACAAGCAACGAGATAATAACTTTTATCCTGCTTGGGCTTGGTCTCTTTCCAGCTGGATTCTCCGTGTTCCTTACTCTGCTGTTGAAGCTATTGTTTGGTCTCTTATTGTTTATTATAGCGTCGGCTTTTCCCCTAGTGTAGGAAgGTTTTTTGGTTACGTGTTTGTTCTGTTTTCAATGCACCAGATGGCGTTAGGTCTGTT...

CDS

Download CDS FASTA

2544 bp · LXL04_036556|LXL04_036556|OH1004|CDS

ATGATGTTCAATGGGTTTTCAGAGCTCCCATTAATGATATTTCGGTTACCTGTTTTTTACAAGCAACGAGATAATAACTTTTATCCTGCTTGGGCTTGGTCTCTTTCCAGCTGGATTCTCCGTGTTCCTTACTCTGCTGTTGAAGCTATTGTTTGGTCTCTTATTGTTTATTATAGCGTCGGCTTTTCCCCTAGTGTAGGAAGGTTTTTTGGTTACGTGTTTGTTCTGTTTTCAATGCACCAGATGGCGTTAGGTCTGTT...

Protein

Download Protein FASTA

847 aa · LXL04_036556|LXL04_036556|OH1004|PROTEIN

MMFNGFSELPLMIFRLPVFYKQRDNNFYPAWAWSLSSWILRVPYSAVEAIVWSLIVYYSVGFSPSVGRFFGYVFVLFSMHQMALGLFRTLPVVARNVIIANTFGSAALLVVFLLGGFIMPKDMIKPWWIWGYWLSPLSYAQSAIAVNEFTATRWMKKLIGTNTTLGYTVLQFHDLPTNDNWYWIGVGALLLYAVVFNIIVTLSLAYLNPLKNAQIVPPDASDQTPSSKPDNSSRRHGMTLPFKPLSMSFHNVNYFVDMPK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_036556`
TK1151 ID	TkA04G037300
OH-1004 ID	LXL04_036556
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	98.900
Protein coverage (%)	TK1151 94.898 / OH-1004 76.860 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_036556

Location Chr08:44413071-44417036 (+)

Description Similar to ABCG31: ABC transporter G family member 31

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g29940`	Together with ABCG25, export abscisic acid (ABA) from the endosperm to deliver it to the embryo via ABCG30 and ABCG40-mediated import to suppress radicle extension and subsequent embryonic growth.	The role of Arabidopsis ABCG9 and ABCG31 ATP binding cassette transporters in pollen fitness and the deposition of steryl glycosides on the pollen coat.2014 · DOI: 10.1105/tpc.113.118935 Abscisic acid transporters cooperate to control seed germination.2015 · DOI: 10.1038/ncomms9113
`At3g16340`	May be a general defense protein.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os10g0205500`	May be a general defense protein.	No verified direct reference in this release
`Os06g0554800`	May be a general defense protein.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036556 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0010208 pollen wall assembly Biological Process

GO:0010496 intercellular transport Biological Process

GO:0015850 organic hydroxy compound transport Biological Process

GO:0048581 negative regulation of post-embryonic development Biological Process

GO:0055085 transmembrane transport Biological Process

GO:0080168 abscisic acid transport Biological Process

GO:0140352 export from cell Biological Process

GO:1901140 p-coumaryl alcohol transport Biological Process

GO:1901141 regulation of lignin biosynthetic process Biological Process

GO:1901656 glycoside transport Biological Process

GO:0005739 mitochondrion Cellular Component

KEGG gene cross-reference

ath:AT2G29940

ath:AT3G16340

dosa:Os10g0205500

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.452

Rank 1 · LXL04_036556 · OH-1004

Lysosome / Vacuole0.212

Rank 2 · LXL04_036556 · OH-1004

Endoplasmic reticulum0.188

Rank 3 · LXL04_036556 · OH-1004

Golgi apparatus0.098

Rank 4 · LXL04_036556 · OH-1004

Cytoplasm0.095

Rank 5 · LXL04_036556 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01061.30ABC2_membrane1-149 aa

PF08370.17PDR_assoc154-215 aa

PF00005.34ABC_tran276-427 aa

PF19055.7ABC2_membrane_7456-516 aa

PF01061.30ABC2_membrane573-785 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_036556	`PF01061.30`	ABC2_membrane	1	149	1.2e-91	306.6
LXL04_036556	`PF08370.17`	PDR_assoc	154	215	2.8e-22	78.9
LXL04_036556	`PF00005.34`	ABC_tran	276	427	1.7e-20	74.7
LXL04_036556	`PF19055.7`	ABC2_membrane_7	456	516	1.8e-07	31.1
LXL04_036556	`PF01061.30`	ABC2_membrane	573	785	1.2e-91	306.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q7PC88`	Arabidopsis thaliana	ABC transporter G family member 31	70.000%	Swiss-Prot	strong database homology
`Q94A18`	Arabidopsis thaliana	ABC transporter G family member 29	57.310%	Swiss-Prot	strong database homology
`Q8S628`	Oryza sativa subsp. japonica	ABC transporter G family member 51	64.294%	Swiss-Prot	strong database homology
`Q5Z9S8`	Oryza sativa subsp. japonica	ABC transporter G family member 42	53.370%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card