TkA04G023270 | RubberDandelionOmics

Gene overview

TkA04G023270

Reference: TK1151 Chr: Chr04 Coordinates: 5975714-5981450 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2534 bp · TkA04G023270|TK1151|cDNA

TTACAACACGCCCTACCAATTTTCCCCATTGTATTGTATGTGCCCTACTAATTTCTTTTCGAGTTCGCAACGAAGCTTTCGTTGGTAAGGAGATGCGAAAGAATTGAATCTTAATTCCAGTAGTGTATTTGGATAGTCTGAATCTGTTAAGCTATAAGTGATGGCTCCCAATCCCAGAGTTGCAAAAGCCTTTCGTGCCATGAGAGAGATTGGGATTCCTGAAGAGAAAACAAAACCAGTTTTAAAAGACCTTCTTAAAA...

CDS

Download CDS FASTA

2088 bp · TkA04G023270|TK1151|CDS

ATGGCTCCCAATCCCAGAGTTGCAAAAGCCTTTCGTGCCATGAGAGAGATTGGGATTCCTGAAGAGAAAACAAAACCAGTTTTAAAAGACCTTCTTAAAACCTATGAAAAAAATTGGGAACTTATTGAAGCAGAAAACTATCGAGCACTTGCAGATGCTATTTTCGACAGTGAGGAAGCAGAAGCTTTAGAACAGAAGAAAAAACAAGAAATTGCTGAAGCTGAAGCATTAGAACAGAAAAAGAAACTCGAGTTAGCTGA...

Protein

Download Protein FASTA

695 aa · TkA04G023270|TK1151|PROTEIN

MAPNPRVAKAFRAMREIGIPEEKTKPVLKDLLKTYEKNWELIEAENYRALADAIFDSEEAEALEQKKKQEIAEAEALEQKKKLELAERMKVLEEETQIPEEPERPLKRLRLRHQDSPSCTTSNPNSNTTPLKKPKLEIDDIPYAIPRLRSQGRNKGKQPVSDMTESDVLTETGSESGISVRHLRNKGKEPILSQEKRVVSDRVSSHGVRFKEPKVKQSPFFLVKPKDEPVTDDTSAPAVVPLAVIRPEPLTNGDSSTENG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G023270`
TK1151 ID	TkA04G023270
OH-1004 ID	LXL04_036825
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.900
Protein coverage (%)	TK1151 98.993 / OH-1004 98.286 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G023270

Location Chr04:5975714-5981450 (-)

Description Similar to SUVR2: Probable inactive histone-lysine N-methyltransferase SUVR2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g43990`	Probable inactive histone-lysine methyltransferase that acts as regulator of transcriptional gene silencing independently of histone H3K9 methylation.	SUVR2 is involved in transcriptional gene silencing by associating with SNF2-related chromatin-remodeling proteins in Arabidopsis.2014 · DOI: 10.1038/cr.2014.156
`At3g04380`	Histone methyltransferase that converts monomethylated 'Lys-9' of histone H3 (H3K9me1) to dimethylated 'Lys-9' (H3K9me2) in the absence of bound ubiquitin, and to trimethylated 'Lys-9' (H3K9me3) in the presence of bound ubiquitin.	The SUVR4 histone lysine methyltransferase binds ubiquitin and converts H3K9me1 to H3K9me3 on transposon chromatin in Arabidopsis.2011 · DOI: 10.1371/journal.pgen.1001325
`At1g04050`	Probable inactive histone-lysine methyltransferase that acts as regulator of transcriptional gene silencing independently of histone H3K9 methylation.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036825 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000122 negative regulation of transcription by RNA polymerase II Biological Process

GO:0006325 chromatin organization Biological Process

GO:0006338 chromatin remodeling Biological Process

GO:0006346 DNA methylation-dependent constitutive heterochromatin formation Biological Process

GO:0018026 peptidyl-lysine monomethylation Biological Process

GO:0018027 peptidyl-lysine dimethylation Biological Process

GO:0031047 regulatory ncRNA-mediated gene silencing Biological Process

GO:0032259 methylation Biological Process

GO:0040029 epigenetic regulation of gene expression Biological Process

GO:0045892 negative regulation of DNA-templated transcription Biological Process

GO:0045995 regulation of embryonic development Biological Process

GO:0050821 protein stabilization Biological Process

KEGG gene cross-reference

ath:AT1G04050

ath:AT3G04380

ath:AT5G43990

mmu:77683

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.950

Rank 1 · TkA04G023270 · TK1151

Cytoplasm0.103

Rank 2 · TkA04G023270 · TK1151

Cell membrane0.028

Rank 3 · TkA04G023270 · TK1151

Endoplasmic reticulum0.013

Rank 4 · TkA04G023270 · TK1151

Mitochondrion0.013

Rank 5 · TkA04G023270 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF10440WIYLD6-59 aa

PF00856SET111-119 aa

PF22724NCAB1298-383 aa

PF00856SET537-659 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G023270	`PF10440`	WIYLD	6	59	4.6e-23	81.5
TkA04G023270	`PF00856`	SET	111	119	5.7e-20	72.4
TkA04G023270	`PF22724`	NCAB1	298	383	0.036	14.8
TkA04G023270	`PF00856`	SET	537	659	5.7e-20	72.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FNC7`	Arabidopsis thaliana	sp\|Q9FNC7\|SUVR2_ARATH Probable inactive histone-lysine N-methyltransferase SUVR2	38.000%	Swiss-Prot	Medium
`Q8W595`	Arabidopsis thaliana	sp\|Q8W595\|SUVR4_ARATH Histone-lysine N-methyltransferase SUVR4	61.100%	Swiss-Prot	Low
`Q946J2`	Arabidopsis thaliana	sp\|Q946J2\|SUVR1_ARATH Probable inactive histone-lysine N-methyltransferase SUVR1	37.100%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card