LXL04_036825 | RubberDandelionOmics

Gene overview

LXL04_036825

Reference: OH-1004 Chr: Chr08 Coordinates: 48853997-48858090 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2103 bp · LXL04_036825|LXL04_036825|OH1004|cDNA

ATGGCTCCCAATCCCAGAGTTGCAAAAGCCTTTCGTGCCATGAGAGAGATTGGGATTCCTGAAGAGAAAACAAAACCAGTTTTAAAAGACCTTCTTAAAACCTATGAAAAAAATTGGGAACTTATTGAAGCAGAAAACTATCGAGCACTTGCAGATGCTATTTTCGACAGTGAGGAAGCAGAAGCTTTAGAACAGAAGAAAAAACAAGAAATTGCTGAAGCTGAAGCATTAGAACAGAAAAAGAAACTCGAGTTAGCTGA...

CDS

Download CDS FASTA

2103 bp · LXL04_036825|LXL04_036825|OH1004|CDS

ATGGCTCCCAATCCCAGAGTTGCAAAAGCCTTTCGTGCCATGAGAGAGATTGGGATTCCTGAAGAGAAAACAAAACCAGTTTTAAAAGACCTTCTTAAAACCTATGAAAAAAATTGGGAACTTATTGAAGCAGAAAACTATCGAGCACTTGCAGATGCTATTTTCGACAGTGAGGAAGCAGAAGCTTTAGAACAGAAGAAAAAACAAGAAATTGCTGAAGCTGAAGCATTAGAACAGAAAAAGAAACTCGAGTTAGCTGA...

Protein

Download Protein FASTA

700 aa · LXL04_036825|LXL04_036825|OH1004|PROTEIN

MAPNPRVAKAFRAMREIGIPEEKTKPVLKDLLKTYEKNWELIEAENYRALADAIFDSEEAEALEQKKKQEIAEAEALEQKKKLELAERMKVLEEETQIPEEPERPLKRLRLRHQDSPSCTTSNPNSNTTPLKKPKLEIDDIPYAIPRLRSQGRNKGKQPVSDMTESDVLTETGSESGISVRHLRNKGKEPILSQEKRVVSDRVSSHGVRFKEPKVKQSPVFLVKPKDEPVTDDTSAPAVVPLAVIRPEPLTNGDSSTENG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_036825`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_036825

Location Chr08:48853997-48858090 (+)

Description Similar to SUVR2: Probable inactive histone-lysine N-methyltransferase SUVR2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g43990`	Probable inactive histone-lysine methyltransferase that acts as regulator of transcriptional gene silencing independently of histone H3K9 methylation.	SUVR2 is involved in transcriptional gene silencing by associating with SNF2-related chromatin-remodeling proteins in Arabidopsis.2014 · DOI: 10.1038/cr.2014.156
`At3g04380`	Histone methyltransferase that converts monomethylated 'Lys-9' of histone H3 (H3K9me1) to dimethylated 'Lys-9' (H3K9me2) in the absence of bound ubiquitin, and to trimethylated 'Lys-9' (H3K9me3) in the presence of bound ubiquitin.	The SUVR4 histone lysine methyltransferase binds ubiquitin and converts H3K9me1 to H3K9me3 on transposon chromatin in Arabidopsis.2011 · DOI: 10.1371/journal.pgen.1001325
`At1g04050`	Probable inactive histone-lysine methyltransferase that acts as regulator of transcriptional gene silencing independently of histone H3K9 methylation.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036825 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000122 negative regulation of transcription by RNA polymerase II Biological Process

GO:0006325 chromatin organization Biological Process

GO:0006338 chromatin remodeling Biological Process

GO:0006346 DNA methylation-dependent constitutive heterochromatin formation Biological Process

GO:0018026 peptidyl-lysine monomethylation Biological Process

GO:0018027 peptidyl-lysine dimethylation Biological Process

GO:0031047 regulatory ncRNA-mediated gene silencing Biological Process

GO:0032259 methylation Biological Process

GO:0040029 epigenetic regulation of gene expression Biological Process

GO:0045892 negative regulation of DNA-templated transcription Biological Process

GO:0045995 regulation of embryonic development Biological Process

GO:0050821 protein stabilization Biological Process

KEGG gene cross-reference

ath:AT1G04050

ath:AT3G04380

ath:AT5G43990

mmu:77683

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.942

Rank 1 · LXL04_036825 · OH-1004

Cytoplasm0.113

Rank 2 · LXL04_036825 · OH-1004

Cell membrane0.030

Rank 3 · LXL04_036825 · OH-1004

Endoplasmic reticulum0.014

Rank 4 · LXL04_036825 · OH-1004

Mitochondrion0.014

Rank 5 · LXL04_036825 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF10440.16WIYLD6-59 aa

PF00856.34SET537-659 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_036825	`PF10440.16`	WIYLD	6	59	4.7e-23	81.5
LXL04_036825	`PF00856.34`	SET	537	659	5.3e-20	72.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FNC7`	Arabidopsis thaliana	Probable inactive histone-lysine N-methyltransferase SUVR2	39.186%	Swiss-Prot	moderate database homology
`Q8W595`	Arabidopsis thaliana	Histone-lysine N-methyltransferase SUVR4	55.673%	Swiss-Prot	moderate database homology
`Q946J2`	Arabidopsis thaliana	Probable inactive histone-lysine N-methyltransferase SUVR1	47.661%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card