Gene Card
Gene overview
cDNA / CDS / Protein Sequences
2004 bp · TkA04G012390|TK1151|cDNA
GTCCCCACTTCGCAGTTCAAATTGCCCTGAATACTTTTCAAAGGGTTTTCAATTTGCCGGCGGACCAAAGAGGCGCTCCGGAGTTTTTCAACAGGTGAGAAGTTCAATAACCGGCGTCTCTCTTCAACATCCATCACCGGTTACTTTACCATGGAGTCTCCCACACCAAATCACTTACGCACAATCAAACTCTGGCCTCCAAGTCACGGCACTCGTCTAGTCCTGGTACAACGTATAGTAAAAAACCTTACCTCTCCTTC...
1635 bp · TkA04G012390|TK1151|CDS
ATGGAGTCTCCCACACCAAATCACTTACGCACAATCAAACTCTGGCCTCCAAGTCACGGCACTCGTCTAGTCCTGGTACAACGTATAGTAAAAAACCTTACCTCTCCTTCCATTCTATCCAGAAAATACGGTATCTTAAGCAAAGAAGAAGCAGAAGAAGAAGCAAAACAAATAGAAGCTTCAGCTTTCACCATTGCAAACCAACACTTTGAAAAAGAACCAGATAGTGATGGAGGATCTGCTGTTCAAACTTACGCCAA...
Protein
Download Protein FASTA544 aa · TkA04G012390|TK1151|PROTEIN
MESPTPNHLRTIKLWPPSHGTRLVLVQRIVKNLTSPSILSRKYGILSKEEAEEEAKQIEASAFTIANQHFEKEPDSDGGSAVQTYAKESSKLMVEAVKRGPKPKSEPESEPVPDSLTPQHEQETFFDISGGKRAFIESEEAQELLKPLSEPGNKYTKICFSNRSFGLEAAHVAGPVLSALKQQLTEVDLSDFIAGRPEAEAIEVMTIFSSALEGSNLRYLNLSNNALGEKGVRAFEKLLSSQSNLEELYLMNDGISEEAA...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA04G012390 |
|---|---|
| TK1151 ID | TkA04G012390 |
| OH-1004 ID | LXL04_036977 |
| Relationship / confidence | Rbh High Identity Coverage Synteny / Strict |
| Protein identity (%) | 96.300 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 98.692Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA04G012390 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr04:3098061-3100494 (-) | |||||||||
| Description | Similar to RANGAP1: RAN GTPase-activating protein 1 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0000911 cytokinesis by cell plate formation Biological Process GO:0006606 protein import into nucleus Biological Process GO:0006913 nucleocytoplasmic transport Biological Process GO:0007249 canonical NF-kappaB signal transduction Biological Process GO:0032687 negative regulation of interferon-alpha production Biological Process GO:0032688 negative regulation of interferon-beta production Biological Process GO:0032715 negative regulation of interleukin-6 production Biological Process GO:0032720 negative regulation of tumor necrosis factor production Biological Process GO:0043124 negative regulation of canonical NF-kappaB signal transduction Biological Process GO:0045824 negative regulation of innate immune response Biological Process GO:0048147 negative regulation of fibroblast proliferation Biological Process GO:0050680 negative regulation of epithelial cell proliferation Biological Process | |||||||||
| KEGG gene cross-reference | ath:AT3G63130 ath:AT5G19320 hsa:197358 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF13943WPP12-106 aaPF29265LRR_CARMIL154-437 aaPF12799LRR_4182-191 aaPF13516LRR_6184-191 aaPF29247LRR_MHP1-HER1-GIP3204-278 aaPF13855LRR_8214-252 aaPF29255LRR_NLRC3215-467 aaPF27087LRR_TMOD-LMOD215-333 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA04G012390 | PF13943 | WPP | 12 | 106 | 1.3e-34 | 119.4 |
| TkA04G012390 | PF29265 | LRR_CARMIL | 154 | 437 | 5.4e-13 | 49.2 |
| TkA04G012390 | PF12799 | LRR_4 | 182 | 191 | 6.3e-08 | 33.3 |
| TkA04G012390 | PF13516 | LRR_6 | 184 | 191 | 1.4e-15 | 56.7 |
| TkA04G012390 | PF29247 | LRR_MHP1-HER1-GIP3 | 204 | 278 | 4.9e-07 | 30.0 |
| TkA04G012390 | PF13855 | LRR_8 | 214 | 252 | 0.18 | 12.3 |
| TkA04G012390 | PF29255 | LRR_NLRC3 | 215 | 467 | 7.5e-29 | 101.4 |
| TkA04G012390 | PF27087 | LRR_TMOD-LMOD | 215 | 333 | 2.1e-10 | 41.1 |
| TkA04G012390 | PF13516 | LRR_6 | 216 | 235 | 1.4e-15 | 56.7 |
| TkA04G012390 | PF00560 | LRR_1 | 216 | 238 | 4.2e-09 | 35.5 |
| TkA04G012390 | PF12799 | LRR_4 | 216 | 252 | 6.3e-08 | 33.3 |
| TkA04G012390 | PF29252 | LRR_NLRC4 | 220 | 306 | 0.00015 | 21.8 |
| TkA04G012390 | PF13516 | LRR_6 | 244 | 264 | 1.4e-15 | 56.7 |
| TkA04G012390 | PF00560 | LRR_1 | 244 | 258 | 4.2e-09 | 35.5 |
| TkA04G012390 | PF12799 | LRR_4 | 244 | 281 | 6.3e-08 | 33.3 |
| TkA04G012390 | PF13855 | LRR_8 | 271 | 282 | 0.18 | 12.3 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.