Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1608 bp · LXL04_036977|LXL04_036977|OH1004|cDNA
ATGCTTGCAGGTTACTTTACCATGGAGTCTCCCACACCAAATCACTTACGCACAATCAAACTCTGGCCTCCAAGTCACGGCACTCGTCTAGTCCTGGTACAACGTATAGTAAAAAACCTTACCTCTCCTTCCATTCTATCCAGAAAATACGGTATCTTAAGcaaagaagaagcagaagaagaagcAAAACAAATAGAAGCTTCAGCTTTCACCATTGCAAACCAACACTTTGAAAAAGAACCAGATAGTGATGGAGGATC...
1608 bp · LXL04_036977|LXL04_036977|OH1004|CDS
ATGCTTGCAGGTTACTTTACCATGGAGTCTCCCACACCAAATCACTTACGCACAATCAAACTCTGGCCTCCAAGTCACGGCACTCGTCTAGTCCTGGTACAACGTATAGTAAAAAACCTTACCTCTCCTTCCATTCTATCCAGAAAATACGGTATCTTAAGCAAAGAAGAAGCAGAAGAAGAAGCAAAACAAATAGAAGCTTCAGCTTTCACCATTGCAAACCAACACTTTGAAAAAGAACCAGATAGTGATGGAGGATC...
Protein
Download Protein FASTA535 aa · LXL04_036977|LXL04_036977|OH1004|PROTEIN
MLAGYFTMESPTPNHLRTIKLWPPSHGTRLVLVQRIVKNLTSPSILSRKYGILSKEEAEEEAKQIEASAFTIANQHFEKEPDSDGGSAVQTYAKESSKLMVEAVKRGPKPKSEPESEPVPDSLTPQHEQETFFDISGGKRAFIESEEAQELLKPLSEPGNKYTKICFSNRSFGLEAAHVAGPVLSALKQQLTEVDLSDFIAGRPEAEAIEVMTIFSSALEGSNLRYLNLSNNALGEKGVRAFEKLLSSQSNLEELYLMND...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_036977 |
|---|---|
| TK1151 ID | TkA04G012390 |
| OH-1004 ID | LXL04_036977 |
| Relationship / confidence | Rbh High Identity Coverage Synteny / Strict |
| Protein identity (%) | 96.300 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 98.692Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_036977 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr08:51166438-51168093 (+) | |||||||||
| Description | Similar to RANGAP1: RAN GTPase-activating protein 1 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0000911 cytokinesis by cell plate formation Biological Process GO:0006606 protein import into nucleus Biological Process GO:0006913 nucleocytoplasmic transport Biological Process GO:0007249 canonical NF-kappaB signal transduction Biological Process GO:0032687 negative regulation of interferon-alpha production Biological Process GO:0032688 negative regulation of interferon-beta production Biological Process GO:0032715 negative regulation of interleukin-6 production Biological Process GO:0032720 negative regulation of tumor necrosis factor production Biological Process GO:0043124 negative regulation of canonical NF-kappaB signal transduction Biological Process GO:0045824 negative regulation of innate immune response Biological Process GO:0048147 negative regulation of fibroblast proliferation Biological Process GO:0050680 negative regulation of epithelial cell proliferation Biological Process | |||||||||
| KEGG gene cross-reference | ath:AT3G63130 ath:AT5G19320 hsa:197358 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF13943.12WPP19-113 aaPF29265.1LRR_CARMIL161-444 aaPF29255.1LRR_NLRC3216-343 aaPF27087.1LRR_TMOD-LMOD222-340 aaPF29255.1LRR_NLRC3224-475 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_036977 | PF13943.12 | WPP | 19 | 113 | 1.2e-34 | 119.5 |
| LXL04_036977 | PF29265.1 | LRR_CARMIL | 161 | 444 | 7.4e-13 | 48.7 |
| LXL04_036977 | PF29255.1 | LRR_NLRC3 | 216 | 343 | 1.4e-39 | 136.7 |
| LXL04_036977 | PF27087.1 | LRR_TMOD-LMOD | 222 | 340 | 2e-09 | 38.0 |
| LXL04_036977 | PF29255.1 | LRR_NLRC3 | 224 | 475 | 1.4e-39 | 136.7 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.