TkA04G011070 | RubberDandelionOmics

Gene overview

TkA04G011070

Reference: TK1151 Chr: Chr04 Coordinates: 2668193-2670749 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

813 bp · TkA04G011070|TK1151|cDNA

GTAAAGGTTGCTCCAAAGAGGTGGAGATTGGAGATTAATTTTAGCCAAGATGCGGTGTTGATGCTTTCTTCAATGAATCTGCCTGATGGCATCCAGAGGCGAAGAACCGCAGTTGATGAGCTTAATATGCGTACCATTTTTGAAGAGAATGATGTCATCTGTGCCGAAGTTCGTGATTTTATGCGTGATGGGAGTCTACAACTGCAAGCAAGGAGCCAAAACTAGAACGTGGACAAATGCTAACAATATCTCCATACCTA...

CDS

Download CDS FASTA

978 bp · TkA04G011070|TK1151|CDS

ATGAGAGGTATTGAGCTGCCATTGAATCAAACGCAGAAAATAAGGCTGCAAAGAGCACTCGAACTACTGGACTCACTGTCTTCGGGAACCAATTCTAATGCTTCCGTCACCGTCGCCGATTCTATTCCGGTTAATCAAGAAGATGGCGTTCTTAAGGGTCATGGCACGACAGAGCTCGAGGGTGAAGTTGTGGCAACCGTGTGTGGAGTAATCGAACGTGTAAATAAATTGGTCTATGTTCGCACTTTGAGAGCCAGGTA...

Protein

Download Protein FASTA

325 aa · TkA04G011070|TK1151|PROTEIN

MRGIELPLNQTQKIRLQRALELLDSLSSGTNSNASVTVADSIPVNQEDGVLKGHGTTELEGEVVATVCGVIERVNKLVYVRTLRARYKPEVGDIIVGRVLEVAPKRWRLEINFSQDAVLMLSSMNLPDGIQRRRTAVDELNMRTIFEENDVICAEVRDFMRDGSLQLQARSQKYGKLERGQMLTISPYLVKRRKQHFHHLEQYNIDLILGCNGFIWVGEHVETKDNNMVEDDPIKPIKPQIPIGLEEQEETYTPLETRQN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G011070`
TK1151 ID	TkA04G011070
OH-1004 ID	LXL04_037008
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.100
Protein coverage (%)	TK1151 99.077 / OH-1004 36.261 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G011070

Location Chr04:2668193-2670749 (-)

Description Similar to MTERF4: Transcription termination factor MTERF4, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g03360`	Non-catalytic component of the RNA exosome complex which has 3'->5' exoribonuclease activity and participates in a multitude of cellular RNA processing, maturation and degradation events.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_037008 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000460 maturation of 5.8S rRNA Biological Process

GO:0000467 exonucleolytic trimming to generate mature 3'-end of 5.8S rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) Biological Process

GO:0000956 nuclear-transcribed mRNA catabolic process Biological Process

GO:0006353 DNA-templated transcription termination Biological Process

GO:0006396 RNA processing Biological Process

GO:0008380 RNA splicing Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0032502 developmental process Biological Process

GO:0034475 U4 snRNA 3'-end processing Biological Process

GO:0042254 ribosome biogenesis Biological Process

GO:0042793 plastid transcription Biological Process

GO:0042794 plastid rRNA transcription Biological Process

KEGG gene cross-reference

ath:AT1G03360

ath:AT4G02990

dosa:Os05g0404000

spo:2541813

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.630

Rank 1 · TkA04G011070 · TK1151

Cytoplasm0.434

Rank 2 · TkA04G011070 · TK1151

Mitochondrion0.032

Rank 3 · TkA04G011070 · TK1151

Cell membrane0.024

Rank 4 · TkA04G011070 · TK1151

Lysosome / Vacuole0.021

Rank 5 · TkA04G011070 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14382ECR1_N48-74 aa

PF21266S1_RRP486-157 aa

PF21262RRP40_S187-137 aa

PF15985KH_6180-221 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G011070	`PF14382`	ECR1_N	48	74	8.3e-05	23.0
TkA04G011070	`PF21266`	S1_RRP4	86	157	5.7e-35	120.1
TkA04G011070	`PF21262`	RRP40_S1	87	137	0.028	15.0
TkA04G011070	`PF15985`	KH_6	180	221	6.5e-13	49.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZVT7`	Arabidopsis thaliana	sp\|Q9ZVT7\|RRP4_ARATH Exosome complex component RRP4 homolog	67.700%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card