LXL04_037008 | RubberDandelionOmics

Gene overview

LXL04_037008

Reference: OH-1004 Chr: Chr08 Coordinates: 51604418-51610715 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2667 bp · LXL04_037008|LXL04_037008|OH1004|cDNA

ATGAGAGGTATTGAGCTGCCATTGAATCAAACGCAGAAAATAAGGCTGCAAAGAGCACTCGAACTACTGGACTCACTGTCTTCGGGAACCAATTCTAATGCTTCCGTCACCGTCGCCGATTCTATTCCGGTTAATCAAGAAGATGGCGTTCTTAAGGGTCATGGCACGACAGAGCTCGAGGGTGAAGTTGTGGCAACCGTGTGTGGAGTAATCGAACGTGTAAATAAATTGGTCTATGTTCGCACTTTGAGAGCCAGGTA...

CDS

Download CDS FASTA

2667 bp · LXL04_037008|LXL04_037008|OH1004|CDS

ATGAGAGGTATTGAGCTGCCATTGAATCAAACGCAGAAAATAAGGCTGCAAAGAGCACTCGAACTACTGGACTCACTGTCTTCGGGAACCAATTCTAATGCTTCCGTCACCGTCGCCGATTCTATTCCGGTTAATCAAGAAGATGGCGTTCTTAAGGGTCATGGCACGACAGAGCTCGAGGGTGAAGTTGTGGCAACCGTGTGTGGAGTAATCGAACGTGTAAATAAATTGGTCTATGTTCGCACTTTGAGAGCCAGGTA...

Protein

Download Protein FASTA

888 aa · LXL04_037008|LXL04_037008|OH1004|PROTEIN

MRGIELPLNQTQKIRLQRALELLDSLSSGTNSNASVTVADSIPVNQEDGVLKGHGTTELEGEVVATVCGVIERVNKLVYVRTLRARYKPEVGDIIVGRVLEVAPKRWRLEINFSQDAVLMLSSMNLPDGIQRRRTAVDELNMRTIFEENDVICAEVRDFMRDGSLQLQARSQKYGKLERGQMLTISPYLVKRRKQHFHHLEQYNIDLILGCNGFIWVGEHVETKDNNMVEDDPIKPIKPQIPIGLEEQEETYTPLETRQN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_037008`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_037008

Location Chr08:51604418-51610715 (+)

Description Similar to MTERF4: Transcription termination factor MTERF4, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g02990`	Transcription termination factor required for processing and steady-state levels of plastid transcripts.	No verified direct reference in this release
`At1g03360`	Non-catalytic component of the RNA exosome complex which has 3'->5' exoribonuclease activity and participates in a multitude of cellular RNA processing, maturation and degradation events.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os05g0404000`	Transcription termination factor required for processing and steady-state levels of plastid transcripts.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_037008 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000460 maturation of 5.8S rRNA Biological Process

GO:0000467 exonucleolytic trimming to generate mature 3'-end of 5.8S rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) Biological Process

GO:0000956 nuclear-transcribed mRNA catabolic process Biological Process

GO:0006353 DNA-templated transcription termination Biological Process

GO:0006396 RNA processing Biological Process

GO:0008380 RNA splicing Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0032502 developmental process Biological Process

GO:0034475 U4 snRNA 3'-end processing Biological Process

GO:0042254 ribosome biogenesis Biological Process

GO:0042793 plastid transcription Biological Process

GO:0042794 plastid rRNA transcription Biological Process

KEGG gene cross-reference

ath:AT1G03360

ath:AT4G02990

dosa:Os05g0404000

spo:2541813

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.901

Rank 1 · LXL04_037008 · OH-1004

Mitochondrion0.080

Rank 2 · LXL04_037008 · OH-1004

Nucleus0.054

Rank 3 · LXL04_037008 · OH-1004

Cytoplasm0.032

Rank 4 · LXL04_037008 · OH-1004

Peroxisome0.016

Rank 5 · LXL04_037008 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF21266.4S1_RRP486-157 aa

PF15985.12KH_6180-221 aa

PF02536.20mTERF535-843 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_037008	`PF21266.4`	S1_RRP4	86	157	2.7e-34	117.9
LXL04_037008	`PF15985.12`	KH_6	180	221	1.6e-12	48.2
LXL04_037008	`PF02536.20`	mTERF	535	843	1e-110	370.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZT96`	Arabidopsis thaliana	Transcription termination factor MTERF4, chloroplastic	64.423%	Swiss-Prot	moderate database homology
`Q9ZVT7`	Arabidopsis thaliana	Exosome complex component RRP4 homolog	67.823%	Swiss-Prot	weak database homology
`Q6AUK6`	Oryza sativa subsp. japonica	Transcription termination factor MTERF4, chloroplastic	65.783%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card