TkA04G011050 | RubberDandelionOmics

Gene overview

TkA04G011050

Reference: TK1151 Chr: Chr04 Coordinates: 2661772-2663560 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1166 bp · TkA04G011050|TK1151|cDNA

AAAGTAACTTTCAACAACCTTCCCAAACTATAGGGACTCTATTGTAAAGAGCACTGTTGCCGCAATTACGGACCTCTTCCGATGTCGTTTCGTCAACAGAGCGTTCGAATTATAGACCTCCTCTTCCTTATCCCTCTTTCTCTTCTCCAATGAAGAGCATGAACACTTTGCTGCCAACTTCCGTCTACAAAGCGCCACTGTCGACTTTCTTCTCGATTAATCCTTCAGTTCTTAGATTGACTCCTCGGTTTCGCGGCAAA...

CDS

Download CDS FASTA

681 bp · TkA04G011050|TK1151|CDS

ATGAAGAGCATGAACACTTTGCTGCCAACTTCCGTCTACAAAGCGCCACTGTCGACTTTCTTCTCGATTAATCCTTCAGTTCTTAGATTGACTCCTCGGTTTCGCGGCAAAACCTTCAACGTTCATGCATCTTCAAATGAATCAGATACGAAAACAGTGGAGGAGGGAAAAGAAGAGAACCAGGAATCGATTGGAGCTACGAATGCTGAAACAAAGAAAATTTCAGTTGGAGCAACATCGAGCAGTTCAGCGATCGAGAA...

Protein

Download Protein FASTA

226 aa · TkA04G011050|TK1151|PROTEIN

MKSMNTLLPTSVYKAPLSTFFSINPSVLRLTPRFRGKTFNVHASSNESDTKTVEEGKEENQESIGATNAETKKISVGATSSSSAIEKDLKKVVQKTAATFAPRASTASKNPAVPGTTLYTVFEVQAYASMVLGGALSFNLLFPSNEPDIWRLMGMWSIWMFTIPSLRARDCSKNEKEALNYLFLIVPLLNVTIPFFLKSFALVWSADTVAFFAMYAWKLGWLQKTE

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G011050`
TK1151 ID	TkA04G011050
OH-1004 ID	LXL04_037009
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G011050

Location Chr04:2661772-2663560 (+)

Description Similar to RPH1: Protein RESISTANCE TO PHYTOPHTHORA 1, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g48070`	Plays a positive role in the immune response to the oomycetes P.brassicae, including induced oxidative burst (e.g. H(2)O(2)) and enhanced expression of defense-related genes.	The chloroplast protein RPH1 plays a role in the immune response of Arabidopsis to Phytophthora brassicae.2009 · DOI: 10.1111/j.1365-313x.2008.03779.x

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_037009 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0002229 defense response to oomycetes Biological Process

GO:0006952 defense response Biological Process

GO:0010729 positive regulation of hydrogen peroxide biosynthetic process Biological Process

GO:0050665 hydrogen peroxide biosynthetic process Biological Process

GO:1902290 positive regulation of defense response to oomycetes Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

GO:0016020 membrane Cellular Component

KEGG gene cross-reference

ath:AT2G48070

sot:102592434

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.987

Rank 1 · TkA04G011050 · TK1151

Mitochondrion0.018

Rank 2 · TkA04G011050 · TK1151

Nucleus0.015

Rank 3 · TkA04G011050 · TK1151

Cytoplasm0.014

Rank 4 · TkA04G011050 · TK1151

Cell membrane0.012

Rank 5 · TkA04G011050 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZU82`	Arabidopsis thaliana	sp\|Q9ZU82\|RPH1_ARATH Protein RESISTANCE TO PHYTOPHTHORA 1, chloroplastic	88.400%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card