TkA04G010350 | RubberDandelionOmics

Gene overview

TkA04G010350

Reference: TK1151 Chr: Chr04 Coordinates: 2460738-2463734 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2250 bp · TkA04G010350|TK1151|cDNA

TCAACAGGGAATAACCATGATGTTGTAAGGGCTTTTGATTACACAGAAGAAACGGAAAGCCCATTTCAGAATTTGGATGCAGATACAGAAGAGTTAGATATTCCACATTTTGTTGGGGATCTGAGAGCCCTAATGGTAGATGATAGTGAGGATGAAATTGTGTTGGATAGTGATGACGATGAAGCAATCTCTGACCAAAAACATGGAAAAATCAGAGGAAGTTTATGGAGACATGCACAATCAGTTGATGTTCGTTCTTC...

CDS

Download CDS FASTA

2250 bp · TkA04G010350|TK1151|CDS

TCAACAGGGAATAACCATGATGTTGTAAGGGCTTTTGATTACACAGAAGAAACGGAAAGCCCATTTCAGAATTTGGATGCAGATACAGAAGAGTTAGATATTCCACATTTTGTTGGGGATCTGAGAGCCCTAATGGTAGATGATAGTGAGGATGAAATTGTGTTGGATAGTGATGACGATGAAGCAATCTCTGACCAAAAACATGGAAAAATCAGAGGAAGTTTATGGAGACATGCACAATCAGTTGATGTTCGTTCTTC...

Protein

Download Protein FASTA

749 aa · TkA04G010350|TK1151|PROTEIN

STGNNHDVVRAFDYTEETESPFQNLDADTEELDIPHFVGDLRALMVDDSEDEIVLDSDDDEAISDQKHGKIRGSLWRHAQSVDVRSSAGSNLTDKVSNNENEIVDTKCSKGDQIVNLNDSSINFQDENLVVNESPQPGESSEANALEFVDHYLSISGVNSSPDFKILKNESSRSPFSSCAKGSQKLAMNLKTSSINKAFDWDIDQPDHGCDIFSEKKVEDEGFEELSKHQNDDNVDIFDVGLDTQMAAEAMESLIYATPP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G010350`
TK1151 ID	TkA04G010350
OH-1004 ID	LXL04_028925
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	32.000
Protein coverage (%)	TK1151 79.306 / OH-1004 67.780 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA04G010350`
Location	Chr04:2460738-2463734 (+)
Description	Similar to Paxip1: PAX-interacting protein 1
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_028925` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0000076 DNA replication checkpoint signaling Biological Process GO:0006281 DNA repair Biological Process GO:0006310 DNA recombination Biological Process GO:0006338 chromatin remodeling Biological Process GO:0006351 DNA-templated transcription Biological Process GO:0006974 DNA damage response Biological Process GO:0010212 response to ionizing radiation Biological Process GO:0031398 positive regulation of protein ubiquitination Biological Process GO:0043542 endothelial cell migration Biological Process GO:0060261 positive regulation of transcription initiation by RNA polymerase II Biological Process GO:1902749 regulation of cell cycle G2/M phase transition Biological Process GO:1990166 protein localization to site of double-strand break Biological Process
KEGG gene cross-reference	bta:513213 hsa:22976 mmu:55982 ssc:100144453 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.974

Rank 1 · TkA04G010350 · TK1151

Cytoplasm0.074

Rank 2 · TkA04G010350 · TK1151

Cell membrane0.020

Rank 3 · TkA04G010350 · TK1151

Endoplasmic reticulum0.010

Rank 4 · TkA04G010350 · TK1151

Plastid0.008

Rank 5 · TkA04G010350 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF30476LNK71-104 aa

PF30476LNK168-197 aa

PF16770RTT107_BRCT_5346-354 aa

PF30476LNK454-490 aa

PF16770RTT107_BRCT_5512-603 aa

PF00533BRCT540-590 aa

PF16589BRCT_2558-599 aa

PF00533BRCT628-666 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G010350	`PF30476`	LNK	71	104	0.72	11.2
TkA04G010350	`PF30476`	LNK	168	197	0.72	11.2
TkA04G010350	`PF16770`	RTT107_BRCT_5	346	354	1.4e-13	51.3
TkA04G010350	`PF30476`	LNK	454	490	0.72	11.2
TkA04G010350	`PF16770`	RTT107_BRCT_5	512	603	1.4e-13	51.3
TkA04G010350	`PF00533`	BRCT	540	590	8.7e-05	23.4
TkA04G010350	`PF16589`	BRCT_2	558	599	1.9e-15	57.7
TkA04G010350	`PF00533`	BRCT	628	666	8.7e-05	23.4
TkA04G010350	`PF16589`	BRCT_2	632	716	1.9e-15	57.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card