RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA04G008710
Reference: TK1151 Chr: Chr04 Coordinates: 2085388-2087184 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

1278 bp · TkA04G008710|TK1151|cDNA

GGTTTTGTTTAGTTTTTCCATAAGCTCTTTCTTCTATCAATCATTTGATATCAAAAAGAGAGCTTCATCACCCCACCAACAATGGCTTTCCCTACCCATCTCTTACCTTCTATTTTTGGCATTCTTGGCAACATTATCTCATTTTGTGTGTTCTTAGCGCCACTGCCAACTTTCTATCGAATCTACAAGAAGAAATCGACTGAAGGGTTTCAGTCAGTACCATATTCAGTCGCATTATTCAGCTGCATGTTGCTTTTATA...

CDS

Download CDS FASTA

900 bp · TkA04G008710|TK1151|CDS

ATGGCTTTCCCTACCCATCTCTTACCTTCTATTTTTGGCATTCTTGGCAACATTATCTCATTTTGTGTGTTCTTAGCGCCACTGCCAACTTTCTATCGAATCTACAAGAAGAAATCGACTGAAGGGTTTCAGTCAGTACCATATTCAGTCGCATTATTCAGCTGCATGTTGCTTTTATACTACGGCTATCTCAAAACCGAAAACGGCATGATGATCATCACCATCAACTCAATTGGATGCGTCATCGAAACAATTTACAT...

Protein

Download Protein FASTA

299 aa · TkA04G008710|TK1151|PROTEIN

MAFPTHLLPSIFGILGNIISFCVFLAPLPTFYRIYKKKSTEGFQSVPYSVALFSCMLLLYYGYLKTENGMMIITINSIGCVIETIYIALFLIYATKESLMSTVKLLALFNILSYGLIVVTTRFATDKGPERVAVVGWICAVFSVCVFAAPLSIIRMVIKTKSVEYMPFSLSFFLTLCAVMWFFYGLLIKDYYVATPNVLGFIFGIAQMILYMIYKDKNKQVKSKVQQEDVPATTVVDLGAILEMQEKGAMELGIILEIQE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA04G008710
TK1151 IDTkA04G008710
OH-1004 IDLXL04_037044
Relationship / confidenceMulti Source To Oh1004 / Complex relationship
Protein identity (%)99.000
Protein coverage (%)TK1151 96.990 / OH-1004 92.628
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA04G008710
LocationChr04:2085388-2087184 (-)
DescriptionSimilar to SWEET15: Bidirectional sugar transporter SWEET15
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At5g13170 Mediates both low-affinity uptake and efflux of sugar across the plasma membrane.
An Arabidopsis senescence-associated protein SAG29 regulates cell viability under high salinity.2011 · DOI: 10.1007/s00425-010-1293-8

Rice

Reference gene IDPossible functionPapers / DOI
UniProt: B8BKP4 Mediates both low-affinity uptake and efflux of sugar across the plasma membrane. No verified direct reference in this release
Os11g0508600 Mediates both low-affinity uptake and efflux of sugar across the plasma membrane.
Sugar transporters for intercellular exchange and nutrition of pathogens.2010 · DOI: 10.1038/nature09606
Five phylogenetically close rice SWEET genes confer TAL effector-mediated susceptibility to Xanthomonas oryzae pv. oryzae.2013 · DOI: 10.1111/nph.12411
UniProt: A2X5B4 Mediates both low-affinity uptake and efflux of sugar across the plasma membrane. No verified direct reference in this release
Os02g0513100 Mediates both low-affinity uptake and efflux of sugar across the plasma membrane. No verified direct reference in this release
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_037044 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0008643 carbohydrate transport Biological Process
GO:0009793 embryo development ending in seed dormancy Biological Process
GO:0010150 leaf senescence Biological Process
GO:0010431 seed maturation Biological Process
GO:0015770 sucrose transport Biological Process
GO:0071215 cellular response to abscisic acid stimulus Biological Process
GO:0071446 cellular response to salicylic acid stimulus Biological Process
GO:0071470 cellular response to osmotic stress Biological Process
GO:0000139 Golgi membrane Cellular Component
GO:0005886 plasma membrane Cellular Component
GO:0016020 membrane Cellular Component
GO:0008515 sucrose transmembrane transporter activity Molecular Function
KEGG gene cross-reference
ath:AT5G13170
dosa:Os02g0513100
dosa:Os11g0508600
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.709
Rank 1 · TkA04G008710 · TK1151
Endoplasmic reticulum0.136
Rank 2 · TkA04G008710 · TK1151
Lysosome / Vacuole0.093
Rank 3 · TkA04G008710 · TK1151
Cytoplasm0.082
Rank 4 · TkA04G008710 · TK1151
Golgi apparatus0.054
Rank 5 · TkA04G008710 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03083MtN3_slv11-97 aa
PF04193PQ-loop13-65 aa
PF12669FeoB_associated18-39 aa
PF19727DUF621923-38 aa
PF19727DUF621951-93 aa
PF04193PQ-loop75-89 aa
PF03083MtN3_slv134-218 aa
PF04193PQ-loop134-147 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA04G008710PF03083MtN3_slv11971.4e-55186.0
TkA04G008710PF04193PQ-loop13650.0002521.4
TkA04G008710PF12669FeoB_associated18390.09313.8
TkA04G008710PF19727DUF621923389.86.8
TkA04G008710PF19727DUF621951939.86.8
TkA04G008710PF04193PQ-loop75890.0002521.4
TkA04G008710PF03083MtN3_slv1342181.4e-55186.0
TkA04G008710PF04193PQ-loop1341470.0002521.4
TkA04G008710PF22258DUF69491351937.7e-0523.5
TkA04G008710PF12669FeoB_associated1441610.09313.8
TkA04G008710PF04193PQ-loop1541870.0002521.4
TkA04G008710PF03650MPC1602270.1313.2
TkA04G008710PF12669FeoB_associated1992190.09313.8
TkA04G008710PF04193PQ-loop2002130.0002521.4
TkA04G008710PF19727DUF62192122179.86.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9FY94Arabidopsis thalianasp|Q9FY94|SWT15_ARATH Bidirectional sugar transporter SWEET1559.100%Swiss-ProtHigh
B8BKP4Oryza sativa subsp. indicasp|B8BKP4|SWT14_ORYSI Bidirectional sugar transporter SWEET1461.100%Swiss-ProtHigh
Q2R3P9Oryza sativa subsp. japonicasp|Q2R3P9|SWT14_ORYSJ Bidirectional sugar transporter SWEET1461.100%Swiss-ProtHigh
A2X5B4Oryza sativa subsp. indicasp|A2X5B4|SWT15_ORYSI Bidirectional sugar transporter SWEET1561.300%Swiss-ProtHigh
Q6K602Oryza sativa subsp. japonicasp|Q6K602|SWT15_ORYSJ Bidirectional sugar transporter SWEET1561.300%Swiss-ProtHigh

JBrowse

View in Genome Browser