LXL04_037044 | RubberDandelionOmics

Gene overview

LXL04_037044

Reference: OH-1004 Chr: Chr08 Coordinates: 52174066-52175647 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

939 bp · LXL04_037044|LXL04_037044|OH1004|cDNA

ATGGCTTTCCCTACCCATCTCTTACCTTCTATTTTTGGCATTCTTGGCAACATTATCTCATTTTGTGTGTTCTTAGCGCCACTGCCAACTTTCTATCGAATCTACAAGAAGAAATCGACTGAAGGGTTTCAGTCAGTACCATATTCAGTCGCATTATTCAGCTGCATGTTGCTTTTATACTACGGCTATCTCAAAACCGAAAACGGCATGATGATCATCACCATCAACTCAATTGGATGCGTCATCGAAACAATTTACAT...

CDS

Download CDS FASTA

939 bp · LXL04_037044|LXL04_037044|OH1004|CDS

ATGGCTTTCCCTACCCATCTCTTACCTTCTATTTTTGGCATTCTTGGCAACATTATCTCATTTTGTGTGTTCTTAGCGCCACTGCCAACTTTCTATCGAATCTACAAGAAGAAATCGACTGAAGGGTTTCAGTCAGTACCATATTCAGTCGCATTATTCAGCTGCATGTTGCTTTTATACTACGGCTATCTCAAAACCGAAAACGGCATGATGATCATCACCATCAACTCAATTGGATGCGTCATCGAAACAATTTACAT...

Protein

Download Protein FASTA

312 aa · LXL04_037044|LXL04_037044|OH1004|PROTEIN

MAFPTHLLPSIFGILGNIISFCVFLAPLPTFYRIYKKKSTEGFQSVPYSVALFSCMLLLYYGYLKTENGMMIITINSIGCVIETIYIALFLIYATKESLMSTVKLLALFNILSYGLIVVTTRFATDKGPERVAVVGWICAVFSVCVFAAPLSIIRMVIKTKSVEYMPFSLSFFLTLCAVMWFFYGLLIKDYYVATPNVLGFIFGIAQMILYMIYKDKNKQVKSKVQQEDVPATTVVDLGAILEMQEKGAMELGIILEIQE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_037044`
TK1151 ID	TkA04G008710
OH-1004 ID	LXL04_037044
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.000
Protein coverage (%)	TK1151 96.990 / OH-1004 92.628 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_037044

Location Chr08:52174066-52175647 (+)

Description Similar to SWEET15: Bidirectional sugar transporter SWEET15

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g13170`	Mediates both low-affinity uptake and efflux of sugar across the plasma membrane.	An Arabidopsis senescence-associated protein SAG29 regulates cell viability under high salinity.2011 · DOI: 10.1007/s00425-010-1293-8

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: A2X5B4`	Mediates both low-affinity uptake and efflux of sugar across the plasma membrane.	No verified direct reference in this release
`Os02g0513100`	Mediates both low-affinity uptake and efflux of sugar across the plasma membrane.	No verified direct reference in this release
`Os11g0508600`	Mediates both low-affinity uptake and efflux of sugar across the plasma membrane.	Sugar transporters for intercellular exchange and nutrition of pathogens.2010 · DOI: 10.1038/nature09606 Five phylogenetically close rice SWEET genes confer TAL effector-mediated susceptibility to Xanthomonas oryzae pv. oryzae.2013 · DOI: 10.1111/nph.12411
`UniProt: B8BKP4`	Mediates both low-affinity uptake and efflux of sugar across the plasma membrane.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_037044 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0008643 carbohydrate transport Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0010150 leaf senescence Biological Process

GO:0010431 seed maturation Biological Process

GO:0015770 sucrose transport Biological Process

GO:0071215 cellular response to abscisic acid stimulus Biological Process

GO:0071446 cellular response to salicylic acid stimulus Biological Process

GO:0071470 cellular response to osmotic stress Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0016020 membrane Cellular Component

GO:0008515 sucrose transmembrane transporter activity Molecular Function

KEGG gene cross-reference

ath:AT5G13170

dosa:Os02g0513100

dosa:Os11g0508600

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.738

Rank 1 · LXL04_037044 · OH-1004

Endoplasmic reticulum0.128

Rank 2 · LXL04_037044 · OH-1004

Lysosome / Vacuole0.083

Rank 3 · LXL04_037044 · OH-1004

Cytoplasm0.082

Rank 4 · LXL04_037044 · OH-1004

Golgi apparatus0.050

Rank 5 · LXL04_037044 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03083.22MtN3_slv11-97 aa

PF03083.22MtN3_slv134-218 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_037044	`PF03083.22`	MtN3_slv	11	97	1.6e-55	185.8
LXL04_037044	`PF03083.22`	MtN3_slv	134	218	1.6e-55	185.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FY94`	Arabidopsis thaliana	Bidirectional sugar transporter SWEET15	57.778%	Swiss-Prot	strong database homology
`A2X5B4`	Oryza sativa subsp. indica	Bidirectional sugar transporter SWEET15	61.836%	Swiss-Prot	moderate database homology
`Q6K602`	Oryza sativa subsp. japonica	Bidirectional sugar transporter SWEET15	61.836%	Swiss-Prot	moderate database homology
`Q2R3P9`	Oryza sativa subsp. japonica	Bidirectional sugar transporter SWEET14	61.062%	Swiss-Prot	strong database homology
`B8BKP4`	Oryza sativa subsp. indica	Bidirectional sugar transporter SWEET14	61.062%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card