Gene Card
Gene overview
cDNA / CDS / Protein Sequences
3301 bp · TkA03G601980|TK1151|cDNA
CCATCATTGGGGTGGAGAAGGGGTTTTAATTATTTAACGACTTTTAACAATGAACTATATCAAGAAATTGCAGTTGAGGACTTCATTTTCTCAAACTTTTCAAACCACACGCACATCTTTTATGTTTTCCCCACCCTGACTATGGAAGAATTTTGATGCTCAGATTCACCATTATCATATTCACATCATCACGAAGAGATCAATCAAGTCTCAGATCTTAATTTCTCGTCACAGATCACCGTAGCTGATCTCTCCCAGAT...
2709 bp · TkA03G601980|TK1151|CDS
ATGAATCCCTTCTCGTCTGGGACGCGTCTAAGGGACATGATTCGGGCAATACGTGCCTGTAAAACTGCAGCAGAGGAACGTGCAGTTGTTAGAAAGGAATGTGCTTCAATTCGTGCAGCAGTCAGTGACAATGACAATGATTATAGACACCGTAATTTGGCAAAGCTCATGTTCATTCACATGTTAGGGTACCCCACACATTTTGGTCAAATGGAATGCCTCAAGTTAATTGCAGCTCCTGGATTTCCAGAAAAGAGGAT...
Protein
Download Protein FASTA902 aa · TkA03G601980|TK1151|PROTEIN
MNPFSSGTRLRDMIRAIRACKTAAEERAVVRKECASIRAAVSDNDNDYRHRNLAKLMFIHMLGYPTHFGQMECLKLIAAPGFPEKRIGYLGLMLLLDERQEVLMLVTNSLKQDLNHSNQYIVGLALCALGNISSAEMARDLAPEVERLLQFRDPNVRKKAALCSIRIIKKVPDLAENFVNPVASLLKEKHHGVLLTAIQLCADLCIVSEEALEYFRKKSTEGIVKVLKDAVNSPYAPEYDISGISDPFLQIRLLRMLRIL...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA03G601980 |
|---|---|
| TK1151 ID | TkA03G601980 |
| OH-1004 ID | LXL04_011561 |
| Relationship / confidence | Rbh High Identity Coverage Synteny / Strict |
| Protein identity (%) | 100.000 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA03G601980 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr03:152879764-152887210 (+) | |||||||||
| Description | Similar to At1g60070: AP-1 complex subunit gamma-2 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0006886 intracellular protein transport Biological Process GO:0006896 Golgi to vacuole transport Biological Process GO:0016192 vesicle-mediated transport Biological Process GO:0032438 melanosome organization Biological Process GO:0035646 endosome to melanosome transport Biological Process GO:0060155 platelet dense granule organization Biological Process GO:0090160 Golgi to lysosome transport Biological Process GO:0110010 basolateral protein secretion Biological Process GO:0000139 Golgi membrane Cellular Component GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005765 lysosomal membrane Cellular Component | |||||||||
| KEGG gene cross-reference | ath:AT1G23900 ath:AT1G60070 hsa:164 mmu:11765 pon:100173736 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF01602Adaptin_N26-578 aaPF22928INTS1_R498-122 aaPF23227HEAT_MROH2B_C107-169 aaPF13646HEAT_2110-167 aaPF00514Arm114-134 aaPF13513HEAT_EZ114-132 aaPF12717Cnd1123-212 aaPF13513HEAT_EZ125-162 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA03G601980 | PF01602 | Adaptin_N | 26 | 578 | 2.1e-150 | 502.5 |
| TkA03G601980 | PF22928 | INTS1_R4 | 98 | 122 | 6.5e-10 | 39.6 |
| TkA03G601980 | PF23227 | HEAT_MROH2B_C | 107 | 169 | 0.24 | 11.4 |
| TkA03G601980 | PF13646 | HEAT_2 | 110 | 167 | 5.7e-08 | 33.7 |
| TkA03G601980 | PF00514 | Arm | 114 | 134 | 0.095 | 13.5 |
| TkA03G601980 | PF13513 | HEAT_EZ | 114 | 132 | 0.52 | 11.6 |
| TkA03G601980 | PF12717 | Cnd1 | 123 | 212 | 2.4e-09 | 38.2 |
| TkA03G601980 | PF13513 | HEAT_EZ | 125 | 162 | 0.52 | 11.6 |
| TkA03G601980 | PF22928 | INTS1_R4 | 135 | 207 | 6.5e-10 | 39.6 |
| TkA03G601980 | PF20168 | PDS5 | 140 | 224 | 0.002 | 16.7 |
| TkA03G601980 | PF11698 | V-ATPase_H_C | 145 | 167 | 0.15 | 13.0 |
| TkA03G601980 | PF23271 | HEAT_GCN1 | 146 | 187 | 0.00017 | 22.4 |
| TkA03G601980 | PF00514 | Arm | 147 | 161 | 0.095 | 13.5 |
| TkA03G601980 | PF02985 | HEAT | 152 | 169 | 0.2 | 12.7 |
| TkA03G601980 | PF12755 | Vac14_Fab1_bd | 161 | 215 | 0.039 | 15.3 |
| TkA03G601980 | PF23227 | HEAT_MROH2B_C | 166 | 232 | 0.24 | 11.4 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.