LXL04_011561 | RubberDandelionOmics

Gene overview

LXL04_011561

Reference: OH-1004 Chr: Chr02 Coordinates: 167312124-167319466 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2709 bp · LXL04_011561|LXL04_011561|OH1004|cDNA

ATGAATCCCTTCTCGTCTGGGACGCGTCTAAGGGACATGATTCGGGCAATACGTGCCTGTAAAACTGCAGCAGAAGAACGTGCTGTTGTTAGAAAGGAGTGTGCTTCTATTCGTGCAGCAGTTAGTGACAATGACAATGATTACAGACACCGTAATTTGGCAAAGCTCATGTTCATTCACATGTTAGGGTACCCCACACATTTTGGTCAAATGGAATGCCTCAAGTTAATTGCAGCTCCTGGATTTCCAGAAAAGAGGAT...

CDS

Download CDS FASTA

2709 bp · LXL04_011561|LXL04_011561|OH1004|CDS

ATGAATCCCTTCTCGTCTGGGACGCGTCTAAGGGACATGATTCGGGCAATACGTGCCTGTAAAACTGCAGCAGAAGAACGTGCTGTTGTTAGAAAGGAGTGTGCTTCTATTCGTGCAGCAGTTAGTGACAATGACAATGATTACAGACACCGTAATTTGGCAAAGCTCATGTTCATTCACATGTTAGGGTACCCCACACATTTTGGTCAAATGGAATGCCTCAAGTTAATTGCAGCTCCTGGATTTCCAGAAAAGAGGAT...

Protein

Download Protein FASTA

902 aa · LXL04_011561|LXL04_011561|OH1004|PROTEIN

MNPFSSGTRLRDMIRAIRACKTAAEERAVVRKECASIRAAVSDNDNDYRHRNLAKLMFIHMLGYPTHFGQMECLKLIAAPGFPEKRIGYLGLMLLLDERQEVLMLVTNSLKQDLNHSNQYIVGLALCALGNISSAEMARDLAPEVERLLQFRDPNVRKKAALCSIRIIKKVPDLAENFVNPVASLLKEKHHGVLLTAIQLCADLCIVSEEALEYFRKKSTEGIVKVLKDAVNSPYAPEYDISGISDPFLQIRLLRMLRIL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_011561`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_011561

Location Chr02:167312124-167319466 (+)

Description Similar to At1g60070: AP-1 complex subunit gamma-2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g60070`	Subunit of clathrin-associated adaptor protein complex 1 that plays a role in protein sorting at the trans-Golgi network and early endosomes (TGN/EE).	No verified direct reference in this release
`At1g23900`	Subunit of clathrin-associated adaptor protein complex 1 that plays a role in protein sorting at the trans-Golgi network and early endosomes (TGN/EE).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_011561 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006886 intracellular protein transport Biological Process

GO:0006896 Golgi to vacuole transport Biological Process

GO:0016192 vesicle-mediated transport Biological Process

GO:0032438 melanosome organization Biological Process

GO:0035646 endosome to melanosome transport Biological Process

GO:0060155 platelet dense granule organization Biological Process

GO:0090160 Golgi to lysosome transport Biological Process

GO:0110010 basolateral protein secretion Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005765 lysosomal membrane Cellular Component

KEGG gene cross-reference

ath:AT1G23900

ath:AT1G60070

hsa:164

mmu:11765

pon:100173736

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.564

Rank 1 · LXL04_011561 · OH-1004

Golgi apparatus0.420

Rank 2 · LXL04_011561 · OH-1004

Nucleus0.137

Rank 3 · LXL04_011561 · OH-1004

Lysosome / Vacuole0.134

Rank 4 · LXL04_011561 · OH-1004

Cell membrane0.131

Rank 5 · LXL04_011561 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01602.27Adaptin_N26-578 aa

PF12717.14Cnd1123-212 aa

PF22928.3INTS1_R4135-207 aa

PF02883.27Alpha_adaptinC2785-899 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_011561	`PF01602.27`	Adaptin_N	26	578	2.1e-150	502.5
LXL04_011561	`PF12717.14`	Cnd1	123	212	2.4e-09	38.2
LXL04_011561	`PF22928.3`	INTS1_R4	135	207	6.5e-10	39.6
LXL04_011561	`PF02883.27`	Alpha_adaptinC2	785	899	2.6e-31	108.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZUI6`	Arabidopsis thaliana	AP-1 complex subunit gamma-2	70.875%	Swiss-Prot	strong database homology
`Q84K16`	Arabidopsis thaliana	AP-1 complex subunit gamma-1	70.686%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card