TkA03G488340 | RubberDandelionOmics

Gene overview

TkA03G488340

Reference: TK1151 Chr: Chr03 Coordinates: 122214746-122215620 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

357 bp · TkA03G488340|TK1151|cDNA

ATGGATGAAGAATTACTCGAACTACAGCGGCAATTTGAATCCGCTCAAGAAGCGAAATCAAGCATTCGTTTATCAGAACGAAACGTTGTTGAATTAGTTCAAAAGCTTCAACAACTCCATATCATCGACTTCGATCTCCTAAACACTGTATGTGGCAAAGAGTACATCACTCCTGTACGTATACTCGGTCTGTTGGAAGTTGGTTCGGAAGTAATCGTGACTTTATTGGAGCCTCGACTTCGATCCCTGTCCAGGTATTC...

CDS

Download CDS FASTA

357 bp · TkA03G488340|TK1151|CDS

ATGGATGAAGAATTACTCGAACTACAGCGGCAATTTGAATCCGCTCAAGAAGCGAAATCAAGCATTCGTTTATCAGAACGAAACGTTGTTGAATTAGTTCAAAAGCTTCAACAACTCCATATCATCGACTTCGATCTCCTAAACACTGTATGTGGCAAAGAGTACATCACTCCTGTACGTATACTCGGTCTGTTGGAAGTTGGTTCGGAAGTAATCGTGACTTTATTGGAGCCTCGACTTCGATCCCTGTCCAGGTATTC...

Protein

Download Protein FASTA

118 aa · TkA03G488340|TK1151|PROTEIN

MDEELLELQRQFESAQEAKSSIRLSERNVVELVQKLQQLHIIDFDLLNTVCGKEYITPVRILGLLEVGSEVIVTLLEPRLRSLSRYSECIPMVTLFVHPSTVEMMDAAVEDAIERCSW

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G488340`
TK1151 ID	TkA03G488340
OH-1004 ID	LXL04_036478
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	83.100
Protein coverage (%)	TK1151 60.169 / OH-1004 8.582 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G488340

Location Chr03:122214746-122215620 (+)

Description Similar to Os05g0117600: E3 UFM1-protein ligase 1 homolog

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g46220`	E3 UFM1-protein ligase that mediates ufmylation of target proteins.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: B8AXB6`	E3 UFM1-protein ligase that mediates ufmylation of target proteins.	No verified direct reference in this release
`Os05g0117600`	E3 UFM1-protein ligase that mediates ufmylation of target proteins.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036478 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000077 DNA damage checkpoint signaling Biological Process

GO:0006281 DNA repair Biological Process

GO:0006974 DNA damage response Biological Process

GO:0008284 positive regulation of cell population proliferation Biological Process

GO:0010468 regulation of gene expression Biological Process

GO:0010508 positive regulation of autophagy Biological Process

GO:0031397 negative regulation of protein ubiquitination Biological Process

GO:0032434 regulation of proteasomal ubiquitin-dependent protein catabolic process Biological Process

GO:0032790 ribosome disassembly Biological Process

GO:0032880 regulation of protein localization Biological Process

GO:0033146 regulation of intracellular estrogen receptor signaling pathway Biological Process

GO:0034976 response to endoplasmic reticulum stress Biological Process

KEGG gene cross-reference

ath:AT3G46220

dosa:Os05g0117600

osa:9266232

rno:313115

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.557

Rank 1 · TkA03G488340 · TK1151

Cytoplasm0.447

Rank 2 · TkA03G488340 · TK1151

Mitochondrion0.074

Rank 3 · TkA03G488340 · TK1151

Cell membrane0.056

Rank 4 · TkA03G488340 · TK1151

Endoplasmic reticulum0.041

Rank 5 · TkA03G488340 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF09743E3_UFM1_ligase4-61 aa

PF28752WHD_RecQ_mid_bact21-45 aa

PF17081SOP433-113 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G488340	`PF09743`	E3_UFM1_ligase	4	61	5.2e-18	66.4
TkA03G488340	`PF28752`	WHD_RecQ_mid_bact	21	45	0.14	12.7
TkA03G488340	`PF17081`	SOP4	33	113	0.11	12.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LX73`	Arabidopsis thaliana	sp\|Q9LX73\|UFL1_ARATH E3 UFM1-protein ligase 1 homolog	80.700%	Swiss-Prot	Low
`B8AXB6`	Oryza sativa subsp. indica	sp\|B8AXB6\|UFL1_ORYSI E3 UFM1-protein ligase 1 homolog	77.200%	Swiss-Prot	Low
`B9FM64`	Oryza sativa subsp. japonica	sp\|B9FM64\|UFL1_ORYSJ E3 UFM1-protein ligase 1 homolog	77.200%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card