TkA03G449900 | RubberDandelionOmics

Gene overview

TkA03G449900

Reference: TK1151 Chr: Chr03 Coordinates: 112249525-112259082 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1674 bp · TkA03G449900|TK1151|cDNA

ATGTTGGTCACGGTTGGCACCTCTTTTCGGTCCAAGCCACCACTCCGAGACTTGTTGGTCACGGCTACGTTGGTCACGGTTGACACCCCTCTTTTCGGGTCCAAGCCACCACTCCAAGTGTTGGAACCTCGAAAGGTGGGGATTACTCTAATACCAATTGATACGAACTCATCCCATACTAGTGGTTCCGTCGGTCCTGGTGATCTCGTGACTTCGGATGGTGTGAACTTGCTGGCTAGCGGGTTGAGATGTCAGCCTGC...

CDS

Download CDS FASTA

1674 bp · TkA03G449900|TK1151|CDS

ATGTTGGTCACGGTTGGCACCTCTTTTCGGTCCAAGCCACCACTCCGAGACTTGTTGGTCACGGCTACGTTGGTCACGGTTGACACCCCTCTTTTCGGGTCCAAGCCACCACTCCAAGTGTTGGAACCTCGAAAGGTGGGGATTACTCTAATACCAATTGATACGAACTCATCCCATACTAGTGGTTCCGTCGGTCCTGGTGATCTCGTGACTTCGGATGGTGTGAACTTGCTGGCTAGCGGGTTGAGATGTCAGCCTGC...

Protein

Download Protein FASTA

557 aa · TkA03G449900|TK1151|PROTEIN

MLVTVGTSFRSKPPLRDLLVTATLVTVDTPLFGSKPPLQVLEPRKVGITLIPIDTNSSHTSGSVGPGDLVTSDGVNLLASGLRCQPAEPDEDGVVILANSPPAKPRFAISFLTFDLSRAHEPTPQIVFFFLRTRSGHLSWSAGHVLPPPILHFAMRSQPKMRKLEGRKRKPAELKCSPAKLLKNGTVTSLTVNDPYPNHPRPTSEECRAVRDDLLAFHGFPKQFLKYREQRLKLLPNADECGSTTSPQPEPAVSSKESVL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G449900`
TK1151 ID	TkA03G449900
OH-1004 ID	LXL04_009589
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	87.800
Protein coverage (%)	TK1151 99.102 / OH-1004 97.653 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G449900

Location Chr03:112249525-112259082 (-)

Description Similar to At3g47830: Putative DNA glycosylase At3g47830

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g47830`	Putative DNA glycosylase At3g47830.	No verified direct reference in this release
`At1g10480`	Probable transcription factor required for the initiation of inflorescence trichomes in response to gibberellin (GA).	Zinc finger protein5 is required for the control of trichome initiation by acting upstream of zinc finger protein8 in Arabidopsis.2011 · DOI: 10.1104/pp.111.180281 ZFP5 encodes a functionally equivalent GIS protein to control trichome initiation.2012 · DOI: 10.4161/psb.7.1.18404 A zinc finger protein gene ZFP5 integrates phytohormone signaling to control root hair development in Arabidopsis.2012 · DOI: 10.1111/j.1365-313x.2012.05094.x
`At1g67030`	Probable transcription factor required for the initiation of inflorescence trichomes in response to gibberellin and cytokinin.	Zinc Finger Protein 6 (ZFP6) regulates trichome initiation by integrating gibberellin and cytokinin signaling in Arabidopsis thaliana.2013 · DOI: 10.1111/nph.12211 The Arabidopsis ZINC FINGER PROTEIN3 Interferes with Abscisic Acid and Light Signaling in Seed Germination and Plant Development.2014 · DOI: 10.1104/pp.113.234294
`At1g68360`	Probable transcription factor required for the initiation of inflorescence trichomes in response to gibberellin and cytokinin.	GLABROUS INFLORESCENCE STEMS3 (GIS3) regulates trichome initiation and development in Arabidopsis.2015 · DOI: 10.1111/nph.13218
`At5g06650`	Probable transcription factor required for the initiation of inflorescence trichomes in response to gibberellin and cytokinin.	Integration of cytokinin and gibberellin signalling by Arabidopsis transcription factors GIS, ZFP8 and GIS2 in the regulation of epidermal cell fate.2007 · DOI: 10.1242/dev.005017

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009589 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006281 DNA repair Biological Process

GO:0006284 base-excision repair Biological Process

GO:0006285 base-excision repair, AP site formation Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0040029 epigenetic regulation of gene expression Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0141166 chromosomal 5-methylcytosine DNA demethylation pathway Biological Process

GO:0141169 chromosomal 5-methylcytosine DNA demethylation, direct 5-methylcytosine excision pathway Biological Process

GO:0005634 nucleus Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0003677 DNA binding Molecular Function

KEGG gene cross-reference

ath:AT2G36490

ath:AT3G47830

dosa:Os01g0217900

dosa:Os05g0445900

osa:9271145

sai:Saci_1497

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.692

Rank 1 · TkA03G449900 · TK1151

Cytoplasm0.229

Rank 2 · TkA03G449900 · TK1151

Mitochondrion0.081

Rank 3 · TkA03G449900 · TK1151

Plastid0.050

Rank 4 · TkA03G449900 · TK1151

Cell membrane0.034

Rank 5 · TkA03G449900 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00730HhH-GPD264-407 aa

PF13912zf-C2H2_6279-286 aa

PF24921RING_XB3-XBAT31424-459 aa

PF13465zf-H2C2_2425-429 aa

PF13894zf-C2H2_4425-431 aa

PF13465zf-H2C2_2443-461 aa

PF13894zf-C2H2_4451-473 aa

PF13912zf-C2H2_6451-476 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G449900	`PF00730`	HhH-GPD	264	407	1.1e-11	45.7
TkA03G449900	`PF13912`	zf-C2H2_6	279	286	3.8	8.3
TkA03G449900	`PF24921`	RING_XB3-XBAT31	424	459	0.21	12.4
TkA03G449900	`PF13465`	zf-H2C2_2	425	429	0.0023	18.9
TkA03G449900	`PF13894`	zf-C2H2_4	425	431	0.0057	18.0
TkA03G449900	`PF13465`	zf-H2C2_2	443	461	0.0023	18.9
TkA03G449900	`PF13894`	zf-C2H2_4	451	473	0.0057	18.0
TkA03G449900	`PF13912`	zf-C2H2_6	451	476	3.8	8.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4JCQ3`	Arabidopsis thaliana	sp\|F4JCQ3\|DG783_ARATH Putative DNA glycosylase At3g47830	59.500%	Swiss-Prot	High
`Q39264`	Arabidopsis thaliana	sp\|Q39264\|ZFP5_ARATH Zinc finger protein 5	34.600%	Swiss-Prot	Medium
`Q39265`	Arabidopsis thaliana	sp\|Q39265\|ZFP6_ARATH Zinc finger protein 6	48.600%	Swiss-Prot	Low
`Q9C9H1`	Arabidopsis thaliana	sp\|Q9C9H1\|GIS3_ARATH Zinc finger protein GIS3	63.400%	Swiss-Prot	Low
`Q9FG05`	Arabidopsis thaliana	sp\|Q9FG05\|GIS2_ARATH Zinc finger protein GIS2	39.500%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card