RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA03G346800
Reference: TK1151 Chr: Chr03 Coordinates: 85312322-85315950 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

3518 bp · TkA03G346800|TK1151|cDNA

GTTGAATCCTTCCTTATTTTAGTACAAACCTGCTATACTTCATTTTGGTTCTGTTTATTTTCTGACTCATTTGAACCACGAATCTCAAGAATCCATTGAAGTAAAGTTTTTAAAGCAGAAGATTTAGCAGCAGAATCATGTCCGCAGAAAAGTTTATACTGATCGTGTTCTTGATTTTAGTCACAGGAAGTGAAGCCATTGGAGAGTTGCTTGACTTCGACAAGGAGGTACTTCTGGGTCTGAGATCATTCCTAGAACAG...

CDS

Download CDS FASTA

3198 bp · TkA03G346800|TK1151|CDS

ATGTCCGCAGAAAAGTTTATACTGATCGTGTTCTTGATTTTAGTCACAGGAAGTGAAGCCATTGGAGAGTTGCTTGACTTCGACAAGGAGGTACTTCTGGGTCTGAGATCATTCCTAGAACAGAGGAATAATGTTAATCAACGCGATTACAACCAATGGGACCCACAAGCGTCTTCGCCGTGTACATGGCCTGGAATTTCATGCTCCGGCAACCGAGTCGTCGGGATTAACCTCTCCAACAACAATATCGCCGGGAAGAT...

Protein

Download Protein FASTA

1065 aa · TkA03G346800|TK1151|PROTEIN

MSAEKFILIVFLILVTGSEAIGELLDFDKEVLLGLRSFLEQRNNVNQRDYNQWDPQASSPCTWPGISCSGNRVVGINLSNNNIAGKIFNNFSALTELAYLDLSTNNIGGSIPVDLSKCQSLKVLNLSHNMIDSELNLTGLGSLEVLDLSVNRLSGNISKSFPMICSSLVVANLSANNFSGEIGNSIDGCIKLKYVDMSANFLTGIISFGFHRFKEFAVCENQLNNMLEPWIFAENCSLETLDLSENAFIGEIPMEISNCK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA03G346800
TK1151 IDTkA03G346800
OH-1004 IDLXL04_031452
Relationship / confidenceMulti Source To Oh1004 / Complex relationship
Protein identity (%)68.500
Protein coverage (%)TK1151 99.531 / OH-1004 98.521
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA03G346800
LocationChr03:85312322-85315950 (-)
DescriptionSimilar to At1g74360: Probable LRR receptor-like serine/threonine-protein kinase At1g74360
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At1g74360 Probable LRR receptor-like serine/threonine-protein kinase At1g74360. No verified direct reference in this release
At5g07280 Receptor with a serine/threonine-protein kinase activity required for the specification of the correct number of male archesporial initials and for the subsequent specification of tapetal and middle cell layer identities. No verified direct reference in this release
At4g39400 Receptor with a dual specificity kinase activity acting on both serine/threonine- and tyrosine-containing substrates.
Brassinosteroid-insensitive dwarf mutants of Arabidopsis accumulate brassinosteroids.1999 · DOI: 10.1104/pp.121.3.743
Brassinosteroid-insensitive-1 is a ubiquitously expressed leucine-rich repeat receptor serine/threonine kinase.2000 · DOI: 10.1104/pp.123.4.1247
The Arabidopsis transthyretin-like protein is a potential substrate of BRASSINOSTEROID-INSENSITIVE 1.2004 · DOI: 10.1105/tpc.104.023903
The Arabidopsis thaliana brassinosteroid receptor (AtBRI1) contains a domain that functions as a guanylyl cyclase in vitro.2007 · DOI: 10.1371/journal.pone.0000449
BSKs mediate signal transduction from the receptor kinase BRI1 in Arabidopsis.2008 · DOI: 10.1126/science.1156973
Tyrosine phosphorylation of the BRI1 receptor kinase emerges as a component of brassinosteroid signaling in Arabidopsis.2009 · DOI: 10.1073/pnas.0810249106
BSKs are partially redundant positive regulators of brassinosteroid signaling in Arabidopsis.2013 · DOI: 10.1111/tpj.12175

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_031452 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0001578 microtubule bundle formation Biological Process
GO:0002215 defense response to nematode Biological Process
GO:0009414 response to water deprivation Biological Process
GO:0009416 response to light stimulus Biological Process
GO:0009647 skotomorphogenesis Biological Process
GO:0009729 detection of brassinosteroid stimulus Biological Process
GO:0009742 brassinosteroid mediated signaling pathway Biological Process
GO:0009755 hormone-mediated signaling pathway Biological Process
GO:0009791 post-embryonic development Biological Process
GO:0009825 multidimensional cell growth Biological Process
GO:0009845 seed germination Biological Process
GO:0009911 positive regulation of flower development Biological Process
KEGG gene cross-reference
ath:AT1G55610
ath:AT1G74360
ath:AT4G39400
sly:101261320
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.862
Rank 1 · TkA03G346800 · TK1151
Endoplasmic reticulum0.090
Rank 2 · TkA03G346800 · TK1151
Cytoplasm0.066
Rank 3 · TkA03G346800 · TK1151
Nucleus0.047
Rank 4 · TkA03G346800 · TK1151
Lysosome / Vacuole0.027
Rank 5 · TkA03G346800 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08263LRRNT_227-69 aa
PF29594LRR_SKP272-154 aa
PF00560LRR_176-94 aa
PF12799LRR_476-107 aa
PF13855LRR_876-107 aa
PF13516LRR_677-85 aa
PF29247LRR_MHP1-HER1-GIP377-106 aa
PF25019LRR_R13L1-DRL2181-148 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA03G346800PF08263LRRNT_227694.8e-0627.5
TkA03G346800PF29594LRR_SKP2721540.03514.1
TkA03G346800PF00560LRR_176941.7e-47149.8
TkA03G346800PF12799LRR_4761072.4e-32110.9
TkA03G346800PF13855LRR_8761073.3e-32110.7
TkA03G346800PF13516LRR_677859.6e-0522.9
TkA03G346800PF29247LRR_MHP1-HER1-GIP3771066.86.5
TkA03G346800PF25019LRR_R13L1-DRL21811480.06813.8
TkA03G346800PF23598LRR_14841457.7e-2691.4
TkA03G346800PF23952LRR_EndoS881510.3212.0
TkA03G346800PF25013LRR_Zer-1911531.9e-0628.8
TkA03G346800PF24048LRR_NXF1-5941523.28.1
TkA03G346800PF00560LRR_1971181.7e-47149.8
TkA03G346800PF13516LRR_6991099.6e-0522.9
TkA03G346800PF24758LRR_At5g563701091300.002718.1
TkA03G346800PF13855LRR_81171533.3e-32110.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
C0LGJ1Arabidopsis thalianasp|C0LGJ1|Y1743_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g7436060.700%Swiss-ProtHigh
Q9LYN8Arabidopsis thalianasp|Q9LYN8|EMS1_ARATH Leucine-rich repeat receptor protein kinase EMS145.500%Swiss-ProtLow
O22476Arabidopsis thalianasp|O22476|BRI1_ARATH Protein BRASSINOSTEROID INSENSITIVE 141.200%Swiss-ProtLow

JBrowse

View in Genome Browser