TkA03G325430 | RubberDandelionOmics

Gene overview

TkA03G325430

Reference: TK1151 Chr: Chr03 Coordinates: 79936929-79945394 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2884 bp · TkA03G325430|TK1151|cDNA

GTGCTCTTAAGGTGATTCTGAAGTTACCCCTATGTACAACAACAGTATATTAGAGGACATGTGTATAGAACAAGGTGCAGAATTTGTCAGAAACACTTTCAATGGATGGAAATCTTTACAAGAGGCTTTAGTTTTGCTAAAAGTGTGGGCCCGACAGAGAACTTCTCTACACACTTATGACTCCTTAAATGGCTATCTTATATCAATCTTAGTGGCATACCTTGCCTCAGAATCTGGTAAATTCCGCATTAACAAGGCAA...

CDS

Download CDS FASTA

3105 bp · TkA03G325430|TK1151|CDS

ATGGCTGCTTCCGAGGAGTACACAGACACCATGAACTTAAAAATCGCAGAGCTAATGAAGGAAGTCCAGCTCGATTACTCTCCCACAACTACAAAAGCCATTAACGACGCTGTTTCCGAAATACAAAAATGCATTAATAAAATCCCTGAAGACCTACATGTTAAGGCCAAATTGGCTCCTAAGTTTGTCAAAGATATTGGTGCAGACAAAGTCGAGTTCAAGTTCAAAAGGCCTAAATCGATTGAAGTTGGTGGAAGCTA...

Protein

Download Protein FASTA

1034 aa · TkA03G325430|TK1151|PROTEIN

MAASEEYTDTMNLKIAELMKEVQLDYSPTTTKAINDAVSEIQKCINKIPEDLHVKAKLAPKFVKDIGADKVEFKFKRPKSIEVGGSYSFQCVVKPDVHVDLYVRLPKECFHEKDFLNHRYHGKRCLYLCIIKKYLDSSSIAEKVEWSFFQNEARKPILVVYPVVKSAGLPGFSVRLIPTADSLFNVQKLNISRNNLHVLSQGDSEVTPMYNNSILEDMCIEQGAEFVRNTFNGWKSLQEALVLLKVWARQRTSLHTYDSL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G325430`
TK1151 ID	TkA03G325430
OH-1004 ID	LXL04_007512
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	97.700
Protein coverage (%)	TK1151 100.000 / OH-1004 93.444 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA03G325430`
Location	Chr03:79936929-79945394 (-)
Description	Similar to nol6: Nucleolar protein 6
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_007512` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006364 rRNA processing Biological Process GO:0006409 tRNA export from nucleus Biological Process GO:0030490 maturation of SSU-rRNA Biological Process GO:0042274 ribosomal small subunit biogenesis Biological Process GO:0000794 condensed nuclear chromosome Cellular Component GO:0005654 nucleoplasm Cellular Component GO:0005694 chromosome Cellular Component GO:0005730 nucleolus Cellular Component GO:0005739 mitochondrion Cellular Component GO:0032040 small-subunit processome Cellular Component GO:0032545 CURI complex Cellular Component GO:0034456 UTP-C complex Cellular Component
KEGG gene cross-reference	dwi:6650980 hsa:65083 mmu:230082 xla:431889 xtr:496825 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.846

Rank 1 · TkA03G325430 · TK1151

Cytoplasm0.159

Rank 2 · TkA03G325430 · TK1151

Mitochondrion0.054

Rank 3 · TkA03G325430 · TK1151

Cell membrane0.025

Rank 4 · TkA03G325430 · TK1151

Endoplasmic reticulum0.016

Rank 5 · TkA03G325430 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03813Nrap50-231 aa

PF13255DUF4046104-150 aa

PF17403Nrap_D2237-381 aa

PF17406Nrap_D5241-301 aa

PF17407Nrap_D6257-289 aa

PF17404Nrap_D3386-534 aa

PF13255DUF4046513-546 aa

PF17405Nrap_D4562-729 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G325430	`PF03813`	Nrap	50	231	2.7e-45	155.2
TkA03G325430	`PF13255`	DUF4046	104	150	0.21	12.8
TkA03G325430	`PF17403`	Nrap_D2	237	381	6e-34	117.7
TkA03G325430	`PF17406`	Nrap_D5	241	301	2.4e-44	151.7
TkA03G325430	`PF17407`	Nrap_D6	257	289	6.8e-13	49.7
TkA03G325430	`PF17404`	Nrap_D3	386	534	1.1e-27	97.9
TkA03G325430	`PF13255`	DUF4046	513	546	0.21	12.8
TkA03G325430	`PF17405`	Nrap_D4	562	729	3.4e-39	135.0
TkA03G325430	`PF17406`	Nrap_D5	733	884	2.4e-44	151.7
TkA03G325430	`PF17403`	Nrap_D2	742	822	6e-34	117.7
TkA03G325430	`PF17407`	Nrap_D6	899	1001	6.8e-13	49.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card