LXL04_007512 | RubberDandelionOmics

Gene overview

LXL04_007512

Reference: OH-1004 Chr: Chr02 Coordinates: 51048648-51055698 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3289 bp · LXL04_007512|LXL04_007512|OH1004|cDNA

CTAATCGATTAAACATTCCGCCTCCCTCAAACCCTCACTGCCTCACACACGCTCGACAGTCGTCTCTCAAACCCTCTCGTCGACTACCTTCTCAAATCGACTACTGCCTCCTGCAAATCGACTCTTGCCTCCGCCTCCTGCAAATCGATTCCAACGTCGGTGCTGCACCCTCCGGCCACAGCTCCTTCTCCGGCTACAGAACGAGCTCTTCCTCTTCCCTCACAGTCGGATTTCAGAGCTACCGACCGCCATGGCTGCTT...

CDS

Download CDS FASTA

3252 bp · LXL04_007512|LXL04_007512|OH1004|CDS

CTGCCTCACACACGCTCGACAGTCGTCTCTCAAACCCTCTCGTCGACTACCTTCTCAAATCGACTACTGCCTCCTGCAAATCGACTCTTGCCTCCGCCTCCTGCAAATCGATTCCAACGTCGGTGCTGCACCCTCCGGCCACAGCTCCTTCTCCGGCTACAGAACGAGCTCTTCCTCTTCCCTCACAGTCGGATTTCAGAGCTACCGACCGCCATGGCTGCTTCCGAGGAGTACACAGACACCATGAACTTAAAAATCGC...

Protein

Download Protein FASTA

1083 aa · LXL04_007512|LXL04_007512|OH1004|PROTEIN

MPHTRSTVVSQTLSSTTFSNRLLPPANRLLPPPPANRFQRRCCTLRPQLLLRLQNELFLFPHSRISELPTAMAASEEYTDTMNLKIAELMKEVQLDYSPTTTKAINDTVSEIKKCINKIPEDLHVKAKLAPKFVKDIGADKVEFKFKRPKSIEVGGSYSFQCVVKPDVHVDLYVRLPKECFHEKDFLNHRYHGKRCLYLCIIKKYLDSSSIAEKVEWSFFQNEARKPILVVYPVVKSAGLPGFSVRLIPTADSLFNVQKL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_007512`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`LXL04_007512`
Location	Chr02:51048648-51055698 (+)
Description	Similar to nol6: Nucleolar protein 6
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_007512` · GCA_047496595.1_OSU_TarKok_2.0.
GO annotations (OH1004 source)	GO:0006364 rRNA processing Biological Process GO:0006409 tRNA export from nucleus Biological Process GO:0030490 maturation of SSU-rRNA Biological Process GO:0042274 ribosomal small subunit biogenesis Biological Process GO:0000794 condensed nuclear chromosome Cellular Component GO:0005654 nucleoplasm Cellular Component GO:0005694 chromosome Cellular Component GO:0005730 nucleolus Cellular Component GO:0005739 mitochondrion Cellular Component GO:0032040 small-subunit processome Cellular Component GO:0032545 CURI complex Cellular Component GO:0034456 UTP-C complex Cellular Component
KEGG gene cross-reference	dwi:6650980 hsa:65083 mmu:230082 xla:431889 xtr:496825 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.841

Rank 1 · LXL04_007512 · OH-1004

Cytoplasm0.151

Rank 2 · LXL04_007512 · OH-1004

Mitochondrion0.055

Rank 3 · LXL04_007512 · OH-1004

Cell membrane0.028

Rank 4 · LXL04_007512 · OH-1004

Endoplasmic reticulum0.018

Rank 5 · LXL04_007512 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03813.22Nrap121-302 aa

PF17403.8Nrap_D2308-452 aa

PF17404.8Nrap_D3457-605 aa

PF17405.9Nrap_D4633-800 aa

PF17406.8Nrap_D5804-955 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_007512	`PF03813.22`	Nrap	121	302	3e-45	155.0
LXL04_007512	`PF17403.8`	Nrap_D2	308	452	6.8e-34	117.5
LXL04_007512	`PF17404.8`	Nrap_D3	457	605	1.1e-27	97.8
LXL04_007512	`PF17405.9`	Nrap_D4	633	800	3.7e-39	134.9
LXL04_007512	`PF17406.8`	Nrap_D5	804	955	2.6e-44	151.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card